SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C8W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C8W0
Domain Number 1 Region: 31-146
Classification Level Classification E-value
Superfamily BRCT domain 1.96e-22
Family DNA ligase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3C8W0
Sequence length 196
Comment (tr|H3C8W0|H3C8W0_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000004682} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
QVIQACGGSVDSTLTGRSTHLLCESQVSNMYVQALREGKRCVTAHWLNTVLKRKKMVPPH
RTLHLPFAFPPGAKPCSQHIMSVTGFVDADRDDLKLMAYLTGARYTGYLCRSNTVLICKE
PVGLKYEKAKEWKIPCVNAQWLCDVLLGNFEALRQIQHSRYSIYTHSEPLMPNPQLVQNL
MAAWKMPVKITPEAMS
Download sequence
Identical sequences H3C8W0
ENSTNIP00000004682 ENSTNIP00000004682 99883.ENSTNIP00000004682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]