SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C8Z6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H3C8Z6
Domain Number - Region: 259-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00712
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3C8Z6
Sequence length 315
Comment (tr|H3C8Z6|H3C8Z6_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000004718} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LQVTVNDEESDESFESSWSYMQSIQSNALWGHDRRKFHKTVTESRAHRLIILKNKVELAQ
FQNTAPEYLTLAEGFWRALSSLPTTYDYAAYRQLFQTYGTHYFSEGSLGGEYQALLELTQ
HALATTSTTSREYERCWRKVKRRFLRKKVKTVCEKLTSSTAASYVTPWSPGTSMRNVPIK
VDVVGGNPGLKRFLSILDLENPEENGRKYDDWASSVKDFPQIIEQKVRPLYELVKEVECA
GLKKLHMKQALEEYLSAEHPCRCRPCHNNGRPLLLGSQCVCVCRLGTSGAACQSGAAVGE
QPGVIHGSWSCWSSW
Download sequence
Identical sequences H3C8Z6
ENSTNIP00000004718 ENSTNIP00000004718 99883.ENSTNIP00000004718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]