SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C9B2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C9B2
Domain Number 1 Region: 31-186,216-340
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.14e-63
Family FCH domain 0.0049
Further Details:      
 
Domain Number 2 Region: 490-673
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.83e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000978
Further Details:      
 
Domain Number 3 Region: 723-779
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000481
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3C9B2
Sequence length 1086
Comment (tr|H3C9B2|H3C9B2_TETNG) SLIT-ROBO Rho GTPase activating protein 3 {ECO:0000313|Ensembl:ENSTNIP00000004834} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MSSHAKVKKDKEIIAEYETQVKEIRNQLVEQFRCLEQQSESRLQLLQDLQEFFRRKAELQ
LEYSRGLEKLAERYSAKIRTSREHQHLKKDQNLMSTVNCWYLVLEQTRRESKDHATLSDI
YNNNVIVRLAHVGEDVIRLFKKSKDIGVQMHEELVKVTNELYTVMKTYHMYHTESLSAEN
KLKEAERQEEKHIGKANDISSALLRYGHDERPQRRSSVKKMEKMKEKRQAKYYENKLKCT
KARNDYLLNLAATNALVAKYYIHDVSDMIDCCDLGYHASLARTLRTYLSAEYSLETSRHE
GLDLLEGAVDAMDIRGDKHKFMDTHNQIFCPPACFDYQPHMGDEVCQLSAQQPVQTELLM
RYHQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSQSTESVKSASSD
SYMSKANISKRRANQQETEGFYFTKYKEYLNGSNLIVKLEAKHELLKQTLGEGERAEYGT
TRGRRNVRARSQDSGQPIPVVVESCVRYINLYGLQQQGIFRVPGSQVEVNDIKNAFERGE
DPLVDDQSDHDINSVAGVLKLYFRGLENPLFPKERFLDLISTTKLDSGVERAHQLHQIIV
TLQRPVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPIPDEQDPVSCQAHVNE
VIKSVIIHHELIFPTQRELEGPVYEKCMAGGEEYCESPHSEPGTLDEVDNGPNTSDEELE
QIEAIAKFDYVGRSPRELSFKKGASLLLYLRASEDWWEGRHNGVDGLIPHQYIVVQDMDD
AFTEGVPRTSNAASGPQHDERAAHRTDHQSPCEHTPEHRYGAAVGRVRVRSDGAAVPRHR
NTTDNHSPSRAPDQPPRVLPRPGSPHKVAVNRGPADSPEKRRLTTFGSAGCISHPERKAF
VESLAQRSSPIAARHPNLGDHKAFETEALAEVRFPSQDIEKTMNTALHELRELERQNVAK
HAPDVVLDTLEPHKHPSGAQDPTGSPLHTMVIRDPDAAQRRSSSSSSSETMTTFKPALSA
RRPNAPLRPPPVRPVRPAPVIGQGQGPQRSSSSSSSGLGSPSITPTDRVFPKPPSPSPSN
SSSSSD
Download sequence
Identical sequences H3C9B2
ENSTNIP00000004834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]