SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C9L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C9L7
Domain Number 1 Region: 22-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-17
Family Growth factor receptor domain 0.002
Further Details:      
 
Domain Number 2 Region: 93-139
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000162
Family Ovomucoid domain III-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3C9L7
Sequence length 143
Comment (tr|H3C9L7|H3C9L7_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000004939} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MKPVSAPLLLIPVLLALPARTAPGCGPCEPAVCAPLPLEGCRSGSVLDSCGCCSVCAAAE
GEACGGRRAGARRCAQGLECIKGNPDKKNKGGVCVCKSDYEVCWSDGVTYSSGCELRSAL
AAQAQGQQPVRVQNKGRCATEPV
Download sequence
Identical sequences H3C9L7
ENSTNIP00000004939 ENSTNIP00000004939 99883.ENSTNIP00000004939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]