SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C9T1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C9T1
Domain Number 1 Region: 6-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.88e-83
Family FCH domain 0.000000000938
Further Details:      
 
Domain Number 2 Region: 474-545
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000223
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3C9T1
Sequence length 559
Comment (tr|H3C9T1|H3C9T1_TETNG) Formin binding protein 1b {ECO:0000313|Ensembl:ENSTNIP00000005003} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VIFSPILQDQFDNLEKHTQWGIEYLEKYTKFVKERSEIELNYAKQIRNLSKKYQPKKNSR
EEEESKYTFCRAFLATLNELNDYAGQHEVIAENLVSQIITELVRYTQDLKAERKSHFHDG
RKAQQHIESSWKQLESCKKKFERDCKEADRANQYFEKLDADINVTKADVEKARQQAQMRQ
QMAADSKNDYSSYLQKFNQEQNEHYFTNIPAIFQKLQDMEEKRIEKLGVCMKTFAEVDRQ
VLPIVGKCLDGMTKAAESIEPKTDSKQVVESYKSGFEPPGDVEFEDYGQAMKRTASETSL
SNSKDGKEKSGSKSKGKLWPFIKNKNKGSGPEDFSHLPPEQRRKKLQGKLDDINKDIQKE
MDQRDALTKMKDVYIKNPQMGDPASVDPRLSEIGQNIEKLQFEAQKFEGWLAEVEERMPS
KSDTHRRSVLYEAQNSTTVGNNCAQDRESPDGSYTEEQNSETQVKAIVNPTSTTPDFDDE
FDDEESLPTIGTCKALYPFEGHNEGTIAMAEGELLYVIEEDKGDGWTRVRRNQDEEGYVP
TSYVEVFLETNAKGAMTYI
Download sequence
Identical sequences H3C9T1
ENSTNIP00000005003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]