SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CAG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CAG4
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.24e-60
Family BAR domain 0.00000156
Further Details:      
 
Domain Number 2 Region: 289-350
Classification Level Classification E-value
Superfamily SH3-domain 1.25e-17
Family SH3-domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CAG4
Sequence length 354
Comment (tr|H3CAG4|H3CAG4_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000005236} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MSVSGMKKQLHRANQLLNERLMGAKGTKLEEDFLKMERSVAVIHALLTELLPRTTAFLQP
NPADRARLSVLNAVSRLRGRARRVGYPQTEGLLGDCMLQYGQELGAASEFGGALSGAGEA
LHLVAQARDALLVDVKCTFIDPLQGLHDSQLKEIRDQLKKVSSRRLDFDYKRRRSGKVPA
GELQQAWGKFVTSRELAEGSMFALLQNDVDQLRILASLVTALLDFHRNAHRILLGLHGNL
QTRLTAASNEPQRRFRPAKMRLGSEVSGLQRQRPGPALLRQAPVRTANTLVLDQPCCRAM
YSFHPNQDGELDFSEGDLIVLTKQVDVNWYEGTLGGRSGLFPVCYVDVLVPLPL
Download sequence
Identical sequences H3CAG4
ENSTNIP00000005236 99883.ENSTNIP00000005236 ENSTNIP00000005236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]