SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CAH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CAH7
Domain Number 1 Region: 43-256
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.45e-76
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000119
Further Details:      
 
Domain Number 2 Region: 547-758
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-56
Family Ankyrin repeat 0.0000188
Further Details:      
 
Domain Number 3 Region: 252-383
Classification Level Classification E-value
Superfamily E set domains 5.37e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000326
Further Details:      
 
Domain Number 4 Region: 817-895
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000165
Family DEATH domain, DD 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CAH7
Sequence length 943
Comment (tr|H3CAH7|H3CAH7_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000005249} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAADEHYLHASNQIFDLPMLDAPWDFTPFPAMAQAPSLRTVDGPFLQIVEQPKQRGFRFR
YGCEGPSHGGLPGASSEKNRNTYPTINVNNYQGPARVVVQLVTALHQSPQLHAHSLVGKQ
CEKGICTADLQPKLPVLCSFPNLGILHVTKKNVTKTLEERMVEAFRMGHNYGVCIHPEID
GQQGEVRVPRELTDHQRSLISSAAAVQAKDMDLSVVRLMFTVFLPDSDGGFSRRLEPVVS
DPIYDSKAPNASNLKIVRMDRTAGCVSGGEEVYLLCDKVQKDDIQVRFYEEDDSGLTWEA
LGDFSPTDVHRQFAIVFKTPKYRDQNLQKPTSVFVQLKRKSDNETSEPKPFTYHPQVIGS
DKEEVQRKRQKTLPNFHDFLHRGGGPGAGGPGSAGGGGGSGCPGSDAHHLSFSPPGFFQG
FTTYKNTVRRTSGRQRGKPQVPFLVRKHPDQLITFNLMVGGVQASQGGAVSSDEDGDPED
GSGSAPRRKARPGIGSHWLDPRPPETAGAVLEVTSGQVEALFRYSVTGEAAHLLATQRSL
MDAQDEDGDSVLHLAVLHHQQEVLKSLVQVLSLLPGQDVLNARNHLYQTPLHLAVLTQQR
EAVQALLLAGADPTLADRHGNTPLHLASQQGGDGGMVGFLLQDEGMRGLLELPNRAGLCP
IHLAVLANQLSSLRELLEGGANVESQERSCGRSALHLATERDNVSLAGCLLLEGNANVDS
CTFDGSTPLHVAAGRGSAKLTALLVAAGADPRKENFEPLFFLQTSWLQSDKEEGYVPGTT
PMNIAATKQQVVELLNGKEYEPKPSLREPKPPPESDLVSLGLQVKQQVCQALEREALWER
LAQALGLGILNTAFRLSPVPARTLLDSYEVSGGTVSELLAALRSLGECQARSILEGALFP
SVDQGAGAANRRTGLCPPLPAGEQLKVELGLDGEACDSGVELS
Download sequence
Identical sequences H3CAH7
99883.ENSTNIP00000005249 ENSTNIP00000005249 ENSTNIP00000005249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]