SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CAJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CAJ1
Domain Number 1 Region: 657-685
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000602
Family Ran binding protein zinc finger-like 0.002
Further Details:      
 
Weak hits

Sequence:  H3CAJ1
Domain Number - Region: 12-50
Classification Level Classification E-value
Superfamily UBA-like 0.0434
Family CUE domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CAJ1
Sequence length 686
Comment (tr|H3CAJ1|H3CAJ1_TETNG) TGF-beta activated kinase 1/MAP3K7 binding protein 2 {ECO:0000313|Ensembl:ENSTNIP00000005263} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAQGTHHIDIQVLHDLRQKFPEVPEGVVSQCVLQNNNNLDACCEYLSQVSPVYLYSEEGN
LSFSDGHAPSRLRNHMTQLNLGLPSQNVHVAPSRDSLRMNGSRTLSHSLSEGPLPSGGAG
GDFLQPEPQSAPVQLHPGLGVFGPAEPPRKPQPPQHLGLLPPGVKASSGAAQPAPRFNPI
TVTLAPNIQTVRNTPTSLHIHGGPQSGLSSPLGNSIYIRPFVSQSGSSRLSQQQGGRAQY
SPTSQPQAQQPPQPGWLVGGPPSTAPRIPQRSTNQGHQTSHVYMPISSPTNPQAPSVLPT
GSQASPSVSQFNIQNISTGPRKNQIEIKLESPQRQLLQHQHGCCCAPAAAPGVPTAPLST
GGAGLSRSQPTVYISASPDGAVAPAGSRSQPKFYISANASNDEGGPRNPPTVYISANPPR
AGTSGPRNMAGQVSMGPAYIHHHPPKSRSSVGAGGTASPRVVVTQPNTKYTFKITVSPNK
PPAVSPGVVSPTFEPNNLLGLPPEHHRVEPEPLHLSDPLSPRRERPPSQGRRLSTGSEDA
AYTQAALLVHQKARMERLWHELEHLSRRRLERSTSTSQIPSVEDMKQLRCRNRLLLIDID
CLTKEIDLLQTRGPHFNPGAIHSFYDNIGFLGPAPPKPRVTPPGGKAAPEQQQEEEEEGA
QWSCTACTFLNHPALNRCEKCEFPRL
Download sequence
Identical sequences H3CAJ1
ENSTNIP00000005263 ENSTNIP00000005263 99883.ENSTNIP00000005263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]