SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CAM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CAM4
Domain Number 1 Region: 3-392
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.37e-124
Family Motor proteins 0.00000000401
Further Details:      
 
Domain Number 2 Region: 451-555
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.23e-23
Family FHA domain 0.00034
Further Details:      
 
Domain Number 3 Region: 1119-1220
Classification Level Classification E-value
Superfamily PX domain 8.76e-23
Family PX domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CAM4
Sequence length 1257
Comment (tr|H3CAM4|H3CAM4_TETNG) Kinesin family member 16Ba {ECO:0000313|Ensembl:ENSTNIP00000005296} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MASVRVAVRVRPMNRREKDLTAACIIKMEGNETSITNVKVHLSVITGDSMRERVKTFTYD
FSYDSMDCKSSAFVSQEKVFRDLGLDVLKAAFEGYNACVFAYGQTGSGKSYTMMGVPGDA
GLIPRFCEGLFSRISEASRWDAASFRTEVSYLEIYNERVRDLLRRKSTQTYNLRVREHPK
DGPYVEDLSKHLVQNYSDVEDLMEAGNINRTTASTGMNDVSSRSHAIFTINFTQAKFDAE
MPSETVSKIHLVDLAGSERADTTGATGVRLKEGGNINKSLVTLGNVISSLADMSSDGVNS
NQKKKSVFVPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYGETLSTLRYANRAKNII
NKPTINEDSNVRLIRELRAEIARLKALLVQGNQIALLDSPTALSMEEKLHQNEARVLELT
KEWTNKWNETQNILKEETLALRKEGIGVVLDSELPHLIGIDDDLLSTGIILYHLKEGRTY
VGREDAATEQDIVLHGLDLESEHCMFENQGGTVTMVPFSSAQCSVNGVLASEPCQLNQGA
VILLGRTNMFRFNHPKEAAKLREKRKSGLLSTFSLSMTDLSQSCENLSTVMLYNPGLEFE
RQQREELEKLELKRRLIKEMEAKHQSEKADLQRLQQEVESQRKESEQVQQRILRQEESLR
RRSQDIESRLRDFLVEKERFEKERRLEVQGPRLQPHRQQDGEVDEEQRRRQEATEQTEIY
RELERLKREREEQKVRLEAQRRRLEEQEREQLTLVGRLEEQLREKHEEATTLLLRDDVRR
LEEEQQALAEIREALLRAKEAGERPGPRDASEEARNAQDRYSSFKEAQVKVLGQLEMELL
QQRERLEKERNLLLLHSRRQQEKETQEACLEEHKLHFKERQLSRIAELLPALAEEKQRAQ
ETLERSGGVDLDNTLYQVEKELEDQEEKLKLHRLSTQQLQQLQETYEFTANVARILESKE
KQQREALEQAVARLERRHSALRRSVSSEPEAEELGPRSCRNLSTELDQQRVEQEIQKLRR
RISEEEEPRSQPAASEEKMSPVHLHTLSPLLPPLSDDSRINAYIEEEVQRRLKNINLVNG
CSGAKDPSSDDENLQNLNPRRHKYERLISRSLGTSASASTLQEPVRISIPRYFLRGQGKD
EHFEFEVKIAVNDDMWTVFRRYSRFREMHKSLKMKYPELAALEFPPKKLFGNRDERMVAE
RRNHLERYLRNLFQVMLSSSNSPLRADGGLQLTKRDVCEFSPFFRKGVFEYSSHGTG
Download sequence
Identical sequences H3CAM4
ENSTNIP00000005296 ENSTNIP00000005296 99883.ENSTNIP00000005296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]