SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CAR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CAR1
Domain Number 1 Region: 12-191
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.35e-30
Family Ankyrin repeat 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CAR1
Sequence length 193
Comment (tr|H3CAR1|H3CAR1_TETNG) Ankyrin repeat domain 22 {ECO:0000313|Ensembl:ENSTNIP00000005333} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MGLVYSQPACRSAYAGDVQGLFAVLSEDPSQLNAPDGHSGDTPLIAACRRGNLRAVQYLL
DNGADVRASNKKRRTALHYVSRRTFSLLDYLMIAVLMPVLLLGYFILGSSQKQRQTVALM
QVVLSSDVDVNAIDYKGNTALHYVCQRKSQRLVPLLLQEEASVHVRNEDGETPLDIATRL
KFNNIVNMLKKAA
Download sequence
Identical sequences H3CAR1
99883.ENSTNIP00000005333 ENSTNIP00000005333 ENSTNIP00000005333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]