SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CAW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CAW1
Domain Number 1 Region: 328-466
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-22
Family Regulator of G-protein signaling, RGS 0.0067
Further Details:      
 
Domain Number 2 Region: 549-681
Classification Level Classification E-value
Superfamily PX domain 1.7e-20
Family PX domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CAW1
Sequence length 925
Comment (tr|H3CAW1|H3CAW1_TETNG) Sorting nexin 14 {ECO:0000313|Ensembl:ENSTNIP00000005383} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MTGLFTSLKRRFKIDVLREAGRQYPVFCFLMLSLVSLTVLLNSYIHVLMVFWSFLAGVAT
FYCSIGPQTLLPSIFFSIKAKKQEQQQELFPLGSSCAVCGKLKCKRHRPTLLLENHQPWL
GLKHSKVDASVAEVFDLVLENFVYPWYRDITDDEACIDELRMTFRFFASVLLRRAQKVDV
PAVCADKVLKAALKHVEIIARARDKVASAEGLQQAALEEYGADLHVALRSRRHERLYLRR
LTEMLFPFLMPPKATECRSLALLLREVMTGAVLLPTLDFMADPPLLAGRVLTLEVHRRGP
QEGVGEWRRRPSVLQRTPLMAAVAPQVLKLELKDIRAQQDLLFRFMSFLKREGAVHVLQF
LLTVEEFNDRILQPELSEGELQRLHAEVLHIYRTYCLDQSADKINFDRFILEEIRSVAEG
PGRDVVKLQTMRCLFEAYEHVLALLERVFTPMFCHSDEYFRHLLMGAEGPARSSRSSRPR
VPPRDRNWSRRGDALAISRIGSRIKGVFRSAAVEGAVPPPSGPSHPDQDPVEEAAAVVED
DGPAEPASEAGRQRNLAAWSVAIPDVRSYDDELKRDKVLVFCIRVERNDRTQAGHQAERW
TVYRRYPEFYVLESRLTQFHGTFEDAQLPSRRLIGPKNQEFLVSKREEFQEYLQQRLLQH
PELSNSQLLADFLSPHSEESQFLDRTLVDVSLGRIFKSVPGKLMKEKGQNLEPFIQSFFN
SCESPKPKPSRPELTVLSPSALSDRKLFNDLFKNNAGTPDGPDRKRTCATFMQVAPVDGV
YDSMMFMARTVFRVPAWLHHVLAAGRILLKNTLEAYMQQHMRSKLEQVLQEHRLVSLITQ
LRDAVFCEGGAQRSLQERHARARQTFQEMLRYLPEWLVRGLGEEGNSQGIRLLFEGLQQP
LLNKQMTYVLLDLAVQELFPELSKV
Download sequence
Identical sequences H3CAW1
ENSTNIP00000005383 99883.ENSTNIP00000005383 ENSTNIP00000005383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]