SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3CB75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CB75
Domain Number 1 Region: 366-542
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.32e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000442
Further Details:      
 
Domain Number 2 Region: 552-643
Classification Level Classification E-value
Superfamily E set domains 1.82e-24
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CB75
Sequence length 664
Comment (tr|H3CB75|H3CB75_TETNG) Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1 {ECO:0000313|Ensembl:ENSTNIP00000005497} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
QKSHYAHVTPMSPPRTLPLSLLRNRLPAQYNNLQSSTIRSVSVMEPHSYDNQDDMSATGY
YSPSNNRPNGAPTLESPRIEITSYGQFLEDEVEKSSLPVAKRVTSIVTLMLPNADGYRDP
SCLSPSSSISSRSCHSDASSYESGFSNYDNSPQNSPWQSPSVSPKSSTLVLPGDGCVSSG
SPRQSPSTSPGTRVTDDSCIGQRGSRPNSPFGAKRKYSFNSGNKHCTYSPNHSPGISPQT
SPRLSVTEETWLPNTNQYTNSAILAAINALTTDGMPELSEAIPMKSRKTSQDPDSSVSLK
MEPGAEDVNPAELCLDEHPTHHFPMKKEGYCSGFLDVPQPLYSWSKPKQLMTCFPPVSLA
LPALDWQLPSSSGPYSLQIEVQPKCHHRAHYETEGSRGAVKAAAGGHPVVQLHGYIESEP
LTLQLFIGTADDRLLRPHAFYQVHRITGKTVSTMSHEAMHNNTKVLEIPLLPDNNMRAMI
DCAGILKLRNSDIELRKGETDIGRKNTRVRMVFRVHIKQATGRTVSLQVASNPIECSQRS
AQELPLVDKQEEMCPASGGERMLVEGHNFQLDSKVVFVEKAQDGHHLWETEAKVVQEASK
STSLLVEIPPYRNQRLSTRVHVNFYVCNGKKKRSQHQHFTFVPANGKAIFKQLKNEGEVV
GGIK
Download sequence
Identical sequences H3CB75
99883.ENSTNIP00000005497 ENSTNIP00000005497 ENSTNIP00000005497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]