SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CBL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CBL1
Domain Number 1 Region: 920-1043
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-25
Family Ankyrin repeat 0.000000664
Further Details:      
 
Domain Number 2 Region: 1-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.89e-19
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 845-867,1050-1110
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-17
Family SH3-domain 0.00017
Further Details:      
 
Weak hits

Sequence:  H3CBL1
Domain Number - Region: 164-243
Classification Level Classification E-value
Superfamily TM1646-like 0.0915
Family TM1646-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CBL1
Sequence length 1119
Comment (tr|H3CBL1|H3CBL1_TETNG) Protein phosphatase 1, regulatory subunit 13Ba {ECO:0000313|Ensembl:ENSTNIP00000005633} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VILTVYLSDTQQMLTEVPVTPATRVIDVVEYCKEAGEGECHLAEVWSGHERVLPPELLLL
DLLQQWGPRRPEVSFYLRHCPAWTRGSLPIETCHFLNANGGAVKVEGEREREETKLNLPR
VELTLSELQEMASRQQQQIEAQQQMLIAKEQRLRYLHQGGRSNQAQSQSEAEKLQRLKER
VETQEARLKKIRAMRGQVDYSKLINGNLSAEIEHVSSLFQEKQAELQSAVLRVDQLTQQL
EDLKRGRLQLHSVSGPAALELRKLYQELQARNRLNLEQSNKLAQNKELLNKRNAQVTVMD
QRIEDLRERLHKKRAELSRMNGGGPSSPQTSGVSGRVAAVCPYIQVPAEGRKDAGYPLLA
DPPQKHTPLSHTRSLSVQPAVLAKVTLATVITAMPGLIDQGGFSIGSDVKQTRKNRLKVF
QISFSSKGEAKRGNEAAIKHPCDLSDTDDTDNAPLADHFGAARRSFRRRNVFLNIQEVFL
NVPLVMVPTPAPRTRQGGITAQPAPCLALPPVRWAGPAPVLQIPPSSLQRLQQRVSISSN
SNQGPAPSSQPSASSPQAERTDPPPAVAVRPYIPDHPSRPQSPRKGPASMNSSSIYSMYL
QQPQAKSYGSLSNRTTVKAGQSFSAVYGKPILPSSSASPSPVPFLQGGGGGGVKTCEQDA
SDGGKGGESGDGAILPPPNVDNIPRPLSPTKLTPVAHSQMRYQSDADLDVLRRRLSNAPR
PLKKRSSITEPEGPQGPNIQKLLYQRFNTLAGSMEGCSANTFYQPECILGEADNVGNVDP
GDKLAEGRSLNAGPLRSSPPSVVVETPKATTAKAEPAGDAPLQPSSSPAAERPEEQNSDN
QRRSSPSHTSVGHGSPSPSPPTHPPLTKVSLRLPLNSVRSLSFKTSSSPPVLQVKRTNLK
KPASERTGHGLRVKFNPLALLLDASLEGEFDLVQRIIYEVENPSMPNDEGITPLHNAVCA
GHHHIVKFLLDFGVNVNAADSDGWTPLHCAASCNSVHLCKMLVESGAAVFATTISDVETA
ADKCEEMEEGYAQCSQFLYGVQEKLGVMNKGSVFALWDYAAQHPDELSFGEGDALAVLRR
SDDAETEWWWARLDDREGYVPRNLLGLYPRIKPRQRSLA
Download sequence
Identical sequences H3CBL1
ENSTNIP00000005633 ENSTNIP00000005633 99883.ENSTNIP00000005633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]