SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CC85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CC85
Domain Number 1 Region: 394-520
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000424
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number 2 Region: 331-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000431
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 3 Region: 290-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000121
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  H3CC85
Domain Number - Region: 371-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0258
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CC85
Sequence length 720
Comment (tr|H3CC85|H3CC85_TETNG) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MARPVLLSLVLASTFLSQGFCSGLFELKMQEFLNKKGVQGNRNCCRGGPASPFQQQQCEC
RTFFRICLKHYQPNASPDPPCNYGGATPVLGSNSFQVPDVLPESSFTNPVRISFALHVAG
GTFTLIIEAFHTDSTEDLSTDNPERLISTMVAQRHLAVGEAWSQDLHAGGRTELRFSYRF
VCDEHYYGDGCSAFCRPRDDAFGHFTCGERGEIVCDAGWKGQYCTEPICLPGCDEEHGFC
EKPGECKCRVGFKGRYCDECIRYPGCLHGTCQQPWQHCQEGWGGLFCNQDLNYCTHHKPC
MNGATCSNTGQGSYTCSCRPGFTGASCEVQVNECAGNPCRNGGSCTDLENTYTCTCPHGF
YGNNCELSAMTCADGPCSNGGRCVDNPEGGYFCQCPRGHAGFNCEKKIDHCSSGPCSNGA
RCVDLVNSYLCQCPDGFTGMNCDHAGDQCSAYPCQNGGTCQEGPDGYSCTCPPGYTGRNC
SSPINRCEHNPCHNGATCHERNNRYVCACAPGYGGRNCQFLLPEHAAVRGSEVPWMAVGS
GVALVLLLLACAVLVGFFRSKAQQGSPADAAGEAETINNLTNNCHRGDRDPAVGVALTPG
VKNINKKMDLCAGDPDEGSSPGRSGCKSRQPPAEYNLAQEVKQEAAVQEQPPSASSGRCR
APESGRGRETRTNNLSSPLCPRSDAPERKSPEPSACADTKYKSVFVMSEEKDECIIATEV
Download sequence
Identical sequences H3CC85
ENSTNIP00000005857 ENSTNIP00000005857 99883.ENSTNIP00000005857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]