SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CCZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CCZ9
Domain Number 1 Region: 125-184,212-455,481-507
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.61e-32
Family Diacylglycerol kinase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CCZ9
Sequence length 517
Comment (tr|H3CCZ9|H3CCZ9_TETNG) Ceramide kinase-like {ECO:0000313|Ensembl:ENSTNIP00000006122} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
ACSDCVLLRGIFKLGKKSHDVLLTRSRLVWTPIIPETPTGDNAHIRIHKTVLVSSQDVFA
VKVKRRRAAGQQTGGAFLGLALFYCRRTGRRLEEDTLHLHNSSSEHTHRWYSTLKEQLQE
FSSRPRCLKVFINPCSHKKEAVHIYREHVAPLFRMADIRTDITVTERKGHALSVMKECKL
DEYDGGGQSEPGCSGEDLVQAYFCQLGWLSPWVVCVGGDGSVAEMCHAMVLRAQLDADSP
EKPVKTVLPLGIIPAAGAIHIVFMGFGITHTAAMHIVLGHLQRVDMCSFSSFGQLVRFGF
SAMFGFGAQSLARAEKKRWMPSPRRREYALVKTLARLRPEDCQISFLPANKSSRNLSERQ
VLAEGAESWTTNQGLYLSISVMSMPCLSPVVPHGLAPNTRLANGSASLIAVGNTSRSEFI
KHLKRYSSSGGQFNFPFVETHDVSAVKIQLQSLASWPEEESEEEESKTSPIIQSEASTFL
WNIDGELVEMANEVLISRVHPSLISLYGEEKEEFMAK
Download sequence
Identical sequences H3CCZ9
ENSTNIP00000006122 ENSTNIP00000006122 99883.ENSTNIP00000006122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]