SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CD70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CD70
Domain Number 1 Region: 204-404
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.03e-55
Family Reprolysin-like 0.0000308
Further Details:      
 
Domain Number 2 Region: 423-497
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.96e-20
Family Blood coagulation inhibitor (disintegrin) 0.0001
Further Details:      
 
Weak hits

Sequence:  H3CD70
Domain Number - Region: 636-670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0364
Family EGF-type module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CD70
Sequence length 872
Comment (tr|H3CD70|H3CD70_TETNG) ADAM metallopeptidase domain 8a {ECO:0000313|Ensembl:ENSTNIP00000006193} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MADLGHFLFMLLVSWGTTSAEPLPHVKKYQTVIPQRLEDPSPSDDAAAHRTFPDVLRFSL
TITEQNYTLHLEKNKHLVGGSFTVTHFSDQGARVTTAPDLRDHCYYHGHVVGVEDSSASV
GLCSGIRGFVHVHGQIYLIEPLAEAETDGGLHAVYNYKHLRRKRSSCSHGNQTSYYDHVP
GPSGLFQLASLKRRGQSGERVGKPRTVELVVVVDHTEYKKIGSTKMVESRVLEVANHVDK
LYRPVGIRVMLVGLEIWSYRDLIDVSSDPELTLGRFLKWRQWSLLPRTKHDNAQLITGVD
FDGSTVGLANTNTMCTSNSGAVNEDHNKSPVGVASTIAHEMGHNLGLSHDVENCVCGSQT
TKRGCIMSESVGEAGLSIQGSSAAGSQQQLSTFLEEITPACLLDSPSTSRIYGGPVCGNA
FVEAGEECDCGTAKECRNPCCNATTCKLAAGAQCAAGECCHRCQLKATGSVCRPKSGDCD
LEEYCTGFSASCPRDAFTSNGLACNRGAGYCYNGQCPSHQQHCRRLWGPEAKMAVEACYL
QHGNCRKTLFNQKCSRRDQFCGKLLCSDGWEFPVTSKKFLYPLGNGKQCNEAGMNSEDNY
PPDLAMVPTGTKCGPNMVCYNQRCQDMKSVKPYATSDCSSKCNNRGVCNHENKCHCDPGW
APPYCDVLLSELPRETGSVVLPVSLAVGFLLLLVLVFGGLMCYIKKRPPVKRCLQSASGQ
SNPLFRSGSARGSPRLGPAHIGQPVFVESSATQACKPLFSSRATTAAPKPSRAAPEPPKN
PKPVAQPSQVQQVPRPPSSVGAEVSCCMQSLAPQKKPLPPSRPLPPVASKPVVKSKPPVP
PVKPKPSAYASSLPHTQLLAGRAALMPPNRPR
Download sequence
Identical sequences H3CD70
ENSTNIP00000006193 ENSTNIP00000019639 99883.ENSTNIP00000006193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]