SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CDF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CDF7
Domain Number 1 Region: 356-540
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.09e-58
Family SPRY domain 0.0000129
Further Details:      
 
Domain Number 2 Region: 12-81
Classification Level Classification E-value
Superfamily RING/U-box 3.3e-17
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 140-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000351
Family B-box zinc-binding domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CDF7
Sequence length 544
Comment (tr|H3CDF7|H3CDF7_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000006280} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
PQRVMASSAVVPEEQFWCAVCQQVLADPVTTPCGHNFCQTCIRQRWDRSQVCQCPTCGRT
FRSRPETSVNAAFKELTEAFRNLLVHPPAPPPPGAVVCDVCAAASLQVEAVKSCLVCVTS
YCQAHLEPHLRVGSLKLHKLMAPVRNLPERMCEKHERLLEVFCRDEQRCVCRFCTETEHK
HHHSVAVEDESAVRKVQIKQTLEEFQQMIQERLSKAEEIQNRLQLSAASAAEDLENCDRL
FESLIRSVQERRGDVRAEIRSRQKEAERRAESLIGQLQREAAELQRRTAGLEELLDTEDH
LHLLQSTPLLMAPPAWGPWGQLSVHAQPCVGTARRALSEVEETLAKEMDALRKEEMRRMQ
KYAGDVVLDPDTAHPNILLSADGKQAGRGEPLQTVPDHPKRFDPVICVVARTGFLSGRFY
FQVEVGAKTFWDLGVVRESAGRKGMITSTPENGFWTVRLRSGEEYRALDSPSVLLTLPKR
PRVIGVFTDYEEGTVSFFDAEDQSHVYTFSGCVFSERILPFLSPGVCDGGRNAAPLVITD
PAHH
Download sequence
Identical sequences H3CDF7
ENSTNIP00000006280 ENSTNIP00000006280 99883.ENSTNIP00000006280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]