SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CDW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CDW0
Domain Number 1 Region: 828-1099
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.72e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000496
Further Details:      
 
Domain Number 2 Region: 1096-1396
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-75
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000149
Further Details:      
 
Domain Number 3 Region: 3-141
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.53e-29
Family MAM domain 0.0000218
Further Details:      
 
Domain Number 4 Region: 352-557
Classification Level Classification E-value
Superfamily Fibronectin type III 8.16e-27
Family Fibronectin type III 0.00055
Further Details:      
 
Domain Number 5 Region: 248-386
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000337
Family Fibronectin type III 0.0068
Further Details:      
 
Weak hits

Sequence:  H3CDW0
Domain Number - Region: 185-255
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0582
Family I set domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CDW0
Sequence length 1399
Comment (tr|H3CDW0|H3CDW0_TETNG) Protein tyrosine phosphatase, receptor type, U, a {ECO:0000313|Ensembl:ENSTNIP00000006434} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
AAGCTFDQDSEPGSCDYRQGQDDDLDWQLIRTYSWPHPSPDLLPGSFMMVNSSQHLAGQR
AQLLLQPLSENDTHCIQFSYFLFSRDGHSPGELQLYVRVNGGPKGSAVWNTSGSQGRQWH
QVELAVSTFWPSEYQVQTVSIMLPRHLASGLSLSPEHLFPRSSALGAGEGATWAKMAPMF
VPAQVFLRWKRNGVLLDAPALSRLSHKRLMAAFQVEAQRGEQDLYRCVTLSPRGAAVSNF
GELIVRVPPTPIAPPQLLRAGPTYLIIQLNTNSIVGDGPVIRREVRYRASPSTWTETHGV
GSLTYKVWHLEPDTQYHISVLLTRPGDGGTGAPGPPLISRTKCAEPMRALRGLTATDIQP
RQLSLRWEPLGYNLTRCHTYTLSLCYRYSVPTGGGGTNNATVRECLSVERNTSRFTLRDL
PPFHAVHVRLALANPEGKKESREVTFQTEEDVPGGISSESLSFTPLDDMVFLKWEEPVEP
NGLITQYEISYQSIESSDPGINVPGPRRTVSKLRNETYHMFSGLHPGTTYLVSVRARTAK
GFGQSALTEITTNISAPVFDYEDVPSPLSETESTITVLLRPALARGAPVSAYQVVVVEED
GSRQVRRREVGSGDCFPASPAAAGRGAPHYYTAELAPSSLPEATPFTVGDNHTYNGYWNS
PLDPTRSYLIYFQATSNFKGETRINCIRIARKAACKDAKRALEVSQHAEDMGLILAACVG
APLVLVLLLGALVGVLKKGKKVTLPKASMSYRQEKSRKLSSIDGGLVEAGPLQLDRRLAP
AFMDAHGCASRNEQRSSVTESSSLLGGSPQRRCRRRSSPFHTGQLHPAVRVADLLQHINQ
MKTAEGYGFKQEYQSFFDGWDVSKKKDKTKGRHDSLLSHDRQRPRLPSLLADPCSDYANA
NYIDGYQRSNHFIATQGPKQEMVYDFWRMVWQENCFSIVMITKLLEVGRMKCCKYWPDDS
ELYGDIKITLLKTETLAEYTVRTFAMERRGYPAKHEVRQFHFTSWPEHGVPRHATGLLAF
LRRVKASTPPDAGPVVVHCSVGAGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRIN
MIQTEEQYVFIHDAILEACLCGETAIPVSEFALTYKEMLKVDSQSNTSSLREEFQTLNSV
TPHLDVEECSISLLPRNREKNRSMDVLPPDRSLAFLVAADGESSSYINAALADSFLRPAA
FVVTPHPLPSTTSDFWRLVYDYGCTSVVMLNQLNQSNSAWPCLQYWPEPGLQQLGPVTVE
LLSRTADDDVIIRLFRVQNITRLQEGPLLVRHFQFLRWSPYRDVPDSRKAFLLLAQVHGW
QRECGEGRTAVHCLNGGGRSGTFCACTMILEMIRHHSVADAFFAAKTLRNAKPNMVETME
QYRFCYDLAQEYLECLEVR
Download sequence
Identical sequences H3CDW0
ENSTNIP00000006434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]