SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CE99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CE99
Domain Number 1 Region: 99-215
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.45e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00014
Further Details:      
 
Domain Number 2 Region: 353-473
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-25
Family Ankyrin repeat 0.00049
Further Details:      
 
Domain Number 3 Region: 7-58,106-129
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000257
Family Pleckstrin-homology domain (PH domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CE99
Sequence length 506
Comment (tr|H3CE99|H3CE99_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000006573} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
QDALTVVVEDLRLCSVKPFEDIERRFCFEVLSPSKSCMLQAESEKQRQAWIQAVQASIAS
AYRESPDTSEEKRLDRAASPSTSSIDSASEARERGARGDAILQRIQALPGNQQCCDCGQA
DPRWASINLGVLLCIECSGIHRSLGVHCSKVRSTLDSWEPELLKLMCELGNAVVNRIYEC
SSQDGGSRKPLPSSSRQEKEAWIRAKYVEKRFLKKACSAHAGQRKPERRRQECRRHSSSN
SLAKTRRRYRQEVGSASPSTLSAEAAKFRRESLFCPDELDSLFSYFDTGSGPRSLSSDSG
LGGSTDGSTDFLLFGSVAEEREVSEGSSGEAELERSLYASDTEEGRDLQPGALLHRASRN
QNLAAMAEALAHGADVNSADHADGGKTPLIQAVVGGSLIACEFLLQNAADVNQRDGRGRS
PLHHATYLGHTGQVCLFLKRGAAQGDADQDGQDPLSVAVQQANADIVTLLRLARMNEEMK
ESEGQAAPCACSPTEQQLRKCFQEFI
Download sequence
Identical sequences H3CE99
ENSTNIP00000006573 ENSTNIP00000006573 99883.ENSTNIP00000006573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]