SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CER0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CER0
Domain Number 1 Region: 148-467
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.96e-114
Family Transglutaminase core 0.0000000325
Further Details:      
 
Domain Number 2 Region: 3-147
Classification Level Classification E-value
Superfamily E set domains 4.9e-33
Family Transglutaminase N-terminal domain 0.00051
Further Details:      
 
Domain Number 3 Region: 491-594
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.36e-16
Family Transglutaminase, two C-terminal domains 0.0052
Further Details:      
 
Domain Number 4 Region: 597-668
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000141
Family Transglutaminase, two C-terminal domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CER0
Sequence length 669
Comment (tr|H3CER0|H3CER0_TETNG) Transglutaminase 8 {ECO:0000313|Ensembl:ENSTNIP00000006734} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MADVSICRAVKLHCDSNNLEHHTSQASQDRLLVRRGQAFRLTLELSQAFNQHLHPLTITA
ATGPQPSETRGTLSRVRIPPLPASRPAKAAWKMDLDGSSSASRGVVPLAVTPPADAPVGE
YSLTAAFREESCLLGRLTLLFNPWCPDDGVFLEDEEERAEYVMNEDGVIYKGSYNYISST
RWDYGQFEDSMVDICLKLLDMSHKHKQDPAKDASARRDPVYVGRVLSAMINSDDDHGVLE
GRWSGHYFGGTLPSHWNGSHAILKKWYDSGCLPVKYGQCWVFAAVMCSAMRFLGIPCRLV
TNFRSAHDTDGSLTVDEFYADYGVREKPSPDSVWNFHVWVEGWMRRPDLDADGTYDGWQV
LDPTPQEKSGGTGVFCCGPASVEAIRRGQVGLRYDGAFVFAEVKPPLRRLAVKADGTRVK
IWSDTKDVGKFISTKSVRSDRREDITSAYKPEEGTDEERDVYHETRHMHKIPENRETSLA
DELCVVGDQVTKPEKGKDVELKLVVTSKTTAALHLSINLSVQAMRHAGTPATNIQSQAKK
HTLQPNSELSISVLVPFLSYTKAMLDCESMKVVAQVTEEQNPERAYLAKVDVVLLDPPIS
LTVRVNEARVNQELLATMVFMNPAVLTLRNCTVTLSGSGLLQEEFTCRCVCVCVSSYLIK
HRVLLFPTD
Download sequence
Identical sequences H3CER0
ENSTNIP00000006734 99883.ENSTNIP00000006734 ENSTNIP00000006734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]