SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CEU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CEU3
Domain Number 1 Region: 18-495
Classification Level Classification E-value
Superfamily Sema domain 2.35e-117
Family Sema domain 0.0000286
Further Details:      
 
Domain Number 2 Region: 1336-1466,1661-1850
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-51
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 844-942
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000022
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 4 Region: 1028-1132
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000168
Family E-set domains of sugar-utilizing enzymes 0.076
Further Details:      
 
Domain Number 5 Region: 940-1029
Classification Level Classification E-value
Superfamily E set domains 0.000000000000153
Family Other IPT/TIG domains 0.075
Further Details:      
 
Domain Number 6 Region: 498-547
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000131
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 796-832
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000628
Family Plexin repeat 0.0018
Further Details:      
 
Weak hits

Sequence:  H3CEU3
Domain Number - Region: 1143-1220
Classification Level Classification E-value
Superfamily E set domains 0.000192
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CEU3
Sequence length 1880
Comment (tr|H3CEU3|H3CEU3_TETNG) Plexin A3 {ECO:0000313|Ensembl:ENSTNIP00000006767} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
GPGDQPPVQRSGRAVYRPFDTSLTHLTVHRRSGEVFVGAVNRVLKLSANLTELRSHMTGP
VEDNAKCYPPPSVRACAHRLEWSDNVNKLLLVDYAGNRLVACGSIWQGVCQFLRLEDLFK
LGEPHHRKEHYLSGAREADGMAGVVVGEDDWTTDPKSKKAERSGSRLFIGAAIDGKSEYF
PTLSSRKLVADEESVNMFSLVYQDEFVSSQIKIPSDTLSLYPAFDIYYVYGFSSRTYVYF
LTLQLDTQLTQMDAGGEKFFTSKIVRMCSNDTDFYSYVEFPLGCTKDGVEYRLVQAAYKQ
KPGRRLAQALGLSQEDDVLFVIFSQGQKNRSNPPRETVLCLFTLHDINLAMRERIRSCYR
GEGRLSLPWLLNKELPCIHTPQKIGDDFCGLVLNQPLGGLRVIEGSPLYEDRTEGMGAVA
AYTYGEHTVVFVGTRSGQLKKIRVDGVPTASQNALLYETVTVVEGKPILRDMVFSPDHQF
IYLLSDRQQVSRLPVESCEQYSSCSSCLGSGDPHCGWCVLFNMCSRQEACHKWEEPQHFN
TRLDQCVDISVTPSNLSVTSPSTQLTIRVENVPALSGGVSCVFEDLSETPGEVRPKGQVV
CMSPSLRELPVQMQSPAEQRVVQLSLRSTETGHQFISTSFVYYNCSVLNSCTSCVSSVFP
CHWCKYRHICTNNLQDCSFQEGRVSGMEGCPQIVPTSDILVPAEWVRPITLRARNLPQPQ
SGQKNYECVFNIQGKVQRIPAVRFNSSCIQCQNTSYWYEGDEAGDLPVDFSIVWDGDFFI
DKPTSMKALLYKCEAQRSSCGQCLKAPPAFECGWCVETRKCLLRQHCPTPEQNWMHHGRH
NLRCSHPRITKISPLTGPREGGTRVTIEGENLGLQVKEIAYVQVAGVRCSSVPSQYVSAE
RVVCDMAEALLPHSPGGPVELCIGVCSAEFRTLSSQTYSFVSPSFSRVHPEKGPVSGGTR
LTVTGRHLDAGSSVSCIINKEECLFVKRTNREIICITPASLSGSGPASIRLMIDKAEVTS
SETKYVYTEDPTITSIEPNWTILNGSTMITVTGTNLLTIQEPKVRAKYGGVETSNFCTLV
NDSTMTCLAPGLVYNKLAPPEGALHPEEFGFIFDQVSSLLVLNSTPFTHYPNPIFDPLGS
SGILEVKPGSPIILKGKNLIPPAPGNGRLNYTVLIGESPCLLTVSENQLLCDSPDLTGEQ
RVLILVGGLEYSPGMLHIYSDSALTLPAIIGIGAGGGVLLIAIIAVLIAYKRKTRDADRT
LKRLQLQMDNLESRVALECKEAFAELQTDIQELTNDMDGVKIPFLEYRTYTMRVMFPGIE
EHPVLKELDSPANVEKALRLFSQLLNNKIFLLTFIHTLEAQRSFSMRDRGNVASLLMAAL
QGRMEYATVVLKQLLADLIEKNLENRNHPKLLLRSRTESVAEKMLTNWFTFLLHRFLKEC
AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKQLTLMCIPPEGEAGT
EVPVKVLNCDTVTQVKDKLLDAVYKGIPFSQRPQADDMDLEWRQGRMTRIILQDEDVTTK
IESDWKRLNTLAHYQVTDGSLVALVQKQVSAYNIANSFTFTRSLSKYESLLRTSSSPDSL
RSRAPMITPDQETGTKLWHLVKNHEHSDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDD
LFETVFSTAHRGSALPLAIKYMFDFLDEQADKRQISDPDVRHTWKSNCLPLRFWVNVIKN
PQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERY
YRDITKMPSISDQDMDAYLVEQSRLHGNEFNTLSALSELYFYINKYKEEILTALDRDGYC
RKHKLRHKLEQAINLMSGSS
Download sequence
Identical sequences H3CEU3
ENSTNIP00000006767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]