SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CF43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CF43
Domain Number 1 Region: 72-202
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000424
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 480-607
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000534
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 3 Region: 378-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000146
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 4 Region: 416-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000159
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 5 Region: 237-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000006
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 46-83
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000328
Family EGF-type module 0.017
Further Details:      
 
Domain Number 7 Region: 275-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000328
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 200-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000255
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 341-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000748
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  H3CF43
Domain Number - Region: 607-654
Classification Level Classification E-value
Superfamily FnI-like domain 0.00167
Family VWC domain 0.04
Further Details:      
 
Domain Number - Region: 459-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0718
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CF43
Sequence length 985
Comment (tr|H3CF43|H3CF43_TETNG) Jagged 2b {ECO:0000313|Ensembl:ENSTNIP00000006867} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RCSFGWEGQFCDECKLYPGCVHGTCNLPWQCNCEKNWGGLLCNKDLNYCRYQPCVNGGTC
MNTEPDEYYCACPRGFSGKDCQIAEHACASNPCANGGTCHEVPGAFECRCPPGWEGPTCA
TNLDECASSPCAQGGTCVDLEDGFQCVCPPQWEGKTCQIDVNECAAGLCKNARSCKNLIG
GYLCECFQGWAGLNCDLSVQSCLGQCQNGGTCKGGPQGQRCLCLPGFAGTHCEVQRSVCH
SQPCQNGGQCLAEAEGFACRCPPRFSGRLCEISSPSDPCEPDPCENGAPCHSMEQDFYCA
CAEAYEGKTCGQLRGSCQSAPCQAIDSCTVAVATNDSAGVRHISSNVCGPRGRCISQAGG
NFTCACDPGFSGIYCHENVNDCISGPCGNGGTCIDGVNSFQCVCPEGWEGRLCDLNVNEC
KHNPCKNGGRCVDLVNDFHCECADNWKGKTCHSRESQCDATTCSNGGTCYDHGDAFRCAC
PPGWEGNACNTAKSSTCASSPCSNGGTCVGGGDTFTCICKEGWEGPTCGQNINDCNPHPC
YNGGLCVDGVNWFRCECAPGFAGPDCRININECQSSPCAYGATCVDEINGFRCICPLGRT
GARCQEFVGVGKSCHHAGLQFPHSSRWEEECNSCRCLDGKVDCTKVLCGRRPCLLRPPGR
DPGQQPCPAGQRCVEHGYLRCFSGPCQDWGVCSEAGATLPQAATECQPNGRHLDNSCGRI
TLVFNRDKVPPGTTVENICFELRYLPDTRRLATDHSLLLLCDLSHSNPDAVDVAISFHPE
DLPDHSLVQEAASAIVGSLSKRHNSTVMLAVIEVKVETQVTPPSVDYLVPLLCVLFCLLF
LFCIIVCVWWTRKRRKERERNVRPADDSVNNQWEPLRIVVGQQQQPYLKENNREAEQERK
KLMGPSCRTLELSDDCGGAEAGKQPVGKYCKTAVQASVGPVCTLHSCSPPLKGPHRTPAY
SPKDNCWRNVSAPLMAQKDLRDRCV
Download sequence
Identical sequences H3CF43
ENSTNIP00000006867 99883.ENSTNIP00000006867 ENSTNIP00000006867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]