SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CF73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CF73
Domain Number 1 Region: 28-287
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.87e-47
Family Ankyrin repeat 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CF73
Sequence length 377
Comment (tr|H3CF73|H3CF73_TETNG) Ankyrin repeat and SOCS box containing 16 {ECO:0000313|Ensembl:ENSTNIP00000006897} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
PRQQPLQEVRAPPPQLRCRDAAVHNTFMYGDMKGVYTVLKDPGMVNALLETVKEEMVWTQ
RWPGRWTLSSRVKQTSPLRLAASRGHSGCVEELLFRGAEVNDDPGNTALHDACIGAHAAC
VQLLLAHGADCILLAADGSAPLHLCTSVQSLHCAELLLQGGAEVNVRMQESRLTPLHIAG
RRGLEEHVELFLKHGADVRATSREGETPLNAACAGAERPAEAGRYLRVIQQLLDAGADPR
TAGRKQHTPLHNACSNCSPRIVDVLLQHGARAGATNCLGYTPMDCLLQVVDDFQDQQLGA
VARSLLNHGAKPVPPKVLQRCLPSVSTLEVMLNSYVSLPPCEWVSCLPAHVYQEHQPFLQ
LLSQRGSQPRSLQHLLR
Download sequence
Identical sequences H3CF73
99883.ENSTNIP00000006897 ENSTNIP00000006897 ENSTNIP00000006897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]