SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CFG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CFG4
Domain Number 1 Region: 440-479
Classification Level Classification E-value
Superfamily CCHHC domain 0.00000000000000222
Family CCHHC domain 0.00072
Further Details:      
 
Domain Number 2 Region: 483-522
Classification Level Classification E-value
Superfamily CCHHC domain 0.00000000000000222
Family CCHHC domain 0.00066
Further Details:      
 
Domain Number 3 Region: 584-627
Classification Level Classification E-value
Superfamily CCHHC domain 0.0000000000000068
Family CCHHC domain 0.001
Further Details:      
 
Domain Number 4 Region: 75-119
Classification Level Classification E-value
Superfamily CCHHC domain 0.0000000000000183
Family CCHHC domain 0.0000654
Further Details:      
 
Domain Number 5 Region: 120-158
Classification Level Classification E-value
Superfamily CCHHC domain 0.00000000000051
Family CCHHC domain 0.0014
Further Details:      
 
Domain Number 6 Region: 533-567
Classification Level Classification E-value
Superfamily CCHHC domain 0.0000000745
Family CCHHC domain 0.0023
Further Details:      
 
Weak hits

Sequence:  H3CFG4
Domain Number - Region: 640-685
Classification Level Classification E-value
Superfamily Prefoldin 0.0288
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CFG4
Sequence length 766
Comment (tr|H3CFG4|H3CFG4_TETNG) Myelin transcription factor 1a {ECO:0000313|Ensembl:ENSTNIP00000006988} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
KLRITDDSENWDMSRGNLGLLEKAIALKAGEVAEEVQSSPEYLPPRRLQQERAGRRPPQR
LLRQRHSPSCPDKKEVKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEILAMHENVL
KCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAAKLNKTQDKQVHLQRAAREVSSNSDRVPR
PMCFVKQLEIPQYGSFRPNAAPSTPRANLAKELEKYSKVSFDYASFDVQVFGKRTLIPKT
PSSTESSPKAFKSKSLPKASSPSQSPAGGFSKNATSSGYDYSQDAEAAHMAATAILNLST
RCWERPETLCSVSREPCSKESDIEVDENGTLDLSMKKPKRDGVPASEPPSSSSSSSQPTA
ASLSQGHSQPEWEEPLDFTTQSGVKEEEHEEVELAAPSYTSSDAEDEDQDNLEDRKYPGE
VTSSSFKVKFQAKDSKKELLVCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRTLMAAH
TAELKCPTPGCDGSGHITGNYASHRSLSGCPRAKKSGVKATPTKDDKDDSELLRCTVPGC
DSLGYISGEYATHRHAGCPLAARRQKEGLLNGTPFSWKAFKAEGPTCPTPGCDGSGHANG
SFLTHRSLSGCPRASANKKKAKLPGDEFITAKFRASDVLDNDEDIKQLNKEIGELNESNS
EMEADMVNLHTQISSMEKNLKNLEEENKQMEERNEALFLELSGLSQALIRSLANIRLPTM
EPLSEQNLDSYVDALTHMFTNKDCYQNPENRALLESINQAVKGIEV
Download sequence
Identical sequences H3CFG4
99883.ENSTNIP00000006988 ENSTNIP00000006988 ENSTNIP00000006988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]