SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CFK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CFK4
Domain Number 1 Region: 166-282
Classification Level Classification E-value
Superfamily EF-hand 2.94e-32
Family Osteonectin 0.012
Further Details:      
 
Domain Number 2 Region: 251-345
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.03e-27
Family Thyroglobulin type-1 domain 0.00058
Further Details:      
 
Domain Number 3 Region: 106-152
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000129
Family Ovomucoid domain III-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CFK4
Sequence length 394
Comment (tr|H3CFK4|H3CFK4_TETNG) Sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 {ECO:0000313|Ensembl:ENSTNIP00000007031} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MLSVALLCVCAVAVAFGRVSARSDSGNFLDDKWLTGRWDQFRDEPGTWAPSKPFDQGLDP
AKDPCRKIKCGHHKVCVSEDYKTASCVSQRRVSFKDPSLYQSPGSKCKPCPVVHPSPVCG
TDGHTYSTKCKLDYQACITGKKIAVKCPGTCPCPAPLQTSSTEKTVCSESDLKEVVSRLK
DWFRVLHENGNHKRVKKPEKTKFEVGVFPVCKEPLGWMFSRLDTNFDLQLDQSEIKSLYL
DRNEPCSDTFFKSCNVHADKVITSTEWCTCFQRYTDSPCKTELSSISKKQAGKKLLGQYL
PSCDEDGYYRSHQCHSSSNQCWCVDRYGNEIAGSRTHGPTNCGIILESSGDLGSGDSLFT
DDDEDSFVLSDQAAMDNEDDEDEDDDDINDEYLS
Download sequence
Identical sequences H3CFK4
99883.ENSTNIP00000007031 ENSTNIP00000007031 ENSTNIP00000007031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]