SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CFP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CFP3
Domain Number 1 Region: 14-152
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.02e-29
Family Laminin G-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CFP3
Sequence length 163
Comment (tr|H3CFP3|H3CFP3_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000007070} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
PLWPLAFFGLLATVRMLEFGGAPGQWARYGRWEAGSEGELSFSVRTNASKALVLYLDDGG
NCDFLELLIAAGRLQLRFAIHCAEPATLHMETRVNDDRWHMVLLTRNFRETLLMVDGETK
VAEVKSKRKEMAVVSDLFVGGIPPDVRLSALTSSTVKYEPPFQ
Download sequence
Identical sequences H3CFP3
ENSTNIP00000007070 99883.ENSTNIP00000007070 ENSTNIP00000007070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]