SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CFS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CFS1
Domain Number 1 Region: 22-244
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.38e-35
Family Ankyrin repeat 0.00058
Further Details:      
 
Domain Number 2 Region: 261-309
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000116
Family SOCS box-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CFS1
Sequence length 315
Comment (tr|H3CFS1|H3CFS1_TETNG) Ankyrin repeat and SOCS box-containing 12a {ECO:0000313|Ensembl:ENSTNIP00000007098} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LCAKEINKEPSMLHLRTPEEEQSSWDISQLRQAVLENNDRLLDEMLCQEIYRKVINLRGG
WGIAGTPLHAAVSKGNLSCLQVLLAHGALVDCVDVKAQTPLFTAVRGKYLDCVLALLRAG
ASPNGSSSNNCSPVLTAAREGDAEILKELLKRGAEVNSRSKVLLWTSSARVSSGPLYLAA
VYGHLDCFRLLLLFGADPDYNCTDAGLLSSVKQPKTVLEMCLRHGCGVEYVRLLIDFGAN
VYLPTLIIEKSTKQNEAVELLLHERGNPKALTSQCRLAVRRHLRKIGRIHCIDQLEMPSS
LVNFLQHKPATAIVL
Download sequence
Identical sequences H3CFS1
99883.ENSTNIP00000007098 ENSTNIP00000007098 ENSTNIP00000007098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]