SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CG02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CG02
Domain Number 1 Region: 172-366
Classification Level Classification E-value
Superfamily E set domains 1.35e-75
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000119
Further Details:      
 
Domain Number 2 Region: 63-189
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.61e-22
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CG02
Sequence length 398
Comment (tr|H3CG02|H3CG02_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000007179} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
AMGAVRVHRYSIVSTDEDTLKISRLSLHNGHSPLSQHSAGRLRSRFVKKNGQCNVVFDNM
EDKQRRYLADIFTTCVDIRWRYLLLIFTMTFLLSWLLFGLIFWGVALAHGDFDAPIHEGK
HEWRPCILHIQGFIGAFLFSIETQTTIGYGFRCVTEECPVAVVTVVVQSIVGCIVDSFMI
GTIMAKMVRPKKRAQTLLFSHHAVIALRDGKLCLMWRLGNMRKSHIVEHVRAQLIKPHVT
AEGEYLPLEQTDIDVGYDDGLDRLFLVSPLVVVHEINRNSPLYDMSRDDLQREDFEIVVI
LEGMVEATAMTTQARSSYLAKEILWGHRFEPVVLEKADRFHVDYSRFHKTYEVPSTPLCS
ARELNQGARPLLGSHSPSTFCYENEVALCCGDDEDQVK
Download sequence
Identical sequences H3CG02
99883.ENSTNIP00000007179 ENSTNIP00000007179 ENSTNIP00000007179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]