SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CGM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CGM8
Domain Number 1 Region: 571-667
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-18
Family PDZ domain 0.000011
Further Details:      
 
Domain Number 2 Region: 1798-1868
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.14e-18
Family SAM (sterile alpha motif) domain 0.00023
Further Details:      
 
Domain Number 3 Region: 122-149,266-322
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000852
Family Ankyrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CGM8
Sequence length 1870
Comment (tr|H3CGM8|H3CGM8_TETNG) SH3 and multiple ankyrin repeat domains 2 {ECO:0000313|Ensembl:ENSTNIP00000007406} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=SHANK2 OC=Tetraodon.
Sequence
AHINWLVVRVLIPDLQQTKCLRFDPAATVWSAKQRVLCSLSRSLKGALNYGLFQPPGPGG
QGRFLEEERLLREYPQPISRGVPALEFRYKSRVYKQPPLEEKQICKLHTKANLRRFLDLV
QQRQVEKVSQLLERGLDPNYQDSETGAIPLRLPPRSGVSVSDSRKLNSQQLVVELKTVFV
FTCVRGACVVEHFVGDLCSRLKPLSTLPEDQILRQALFLTRVLELGPLAPPAWHLLLLTP
ASGRSFWRERSSPPFRGGALRSFRTLPSACLSPFLLLLQETCARVLLARGADKEVKNFNG
QSPSQVAIIAGNFELAELIKKHKDSDIVPFREAPAYSKRRRGPSAGNGSEPSSSSLAAPR
VLLRSNSDNNLTRPPQQGPPQPGSSALHRSLSPQLLQQMPSGSPNGNVVVRTMGRGARSR
SPSLSRLGEEVRRAQRQPRPSTSAAAQRSPTCGSGTGTGPWVLRCRAAQEETVSVLPHRN
NHTIKSSTKGKGEKDMCKNKHHNSATEVGGGGVVPGVVPGVCGDGFLLCLADSRADRADR
RKLFRHYTVGSYDSFDASRSGGGGGGGGDCVVDEKTVVLQKKENEGFGFVLRGAKADTPI
EEFTPTPAFPALQYLESVDEGGVAWQAGLRTGDFLIEVNQENVVKVGHRQVVNMIRQGGN
RLLIKVVTVSRNLDPDDTARKKAPPPPKRAPTTALSMRSKSMTSELEELATLRKKKDQFP
WQPSPCVDVQKKRIVFQVTLNKVEEMTHAQKASPIDMKIATIKPRPSSRCLVTAADMNSM
YHDRQGVAVVPPTVPGAYLGIPEKGTMRKQKSIGTAEDEKQGFLTPPLLKFARSLSMPDT
SEDIPPPPAISPPSPPAYNSPAAPGPKGYGATRPSFTQNSANAVTTISQTGNVGTLRGSE
QFESTRTRGRTPVPENPYSEVGNKTLYIPAKPARRKGMLVKQSNVEDSPEKTCHMPASPS
GPVSMPTTPVERTCSSIPIPTIIVKEPSTSSSGKSSQGSSMEIEPTTPEHPPLAPTVGGS
GGLRPDDPLSLSNPFAAAIAGAVRDREKRLEAKKNSVAFQSIDMGDDDFCSPTPTPRLRQ
SKSIDEGMFSSDERLRRILAPPPAAQLGPPVGGGSGNMTDFNTPEPTVHPVTGKPLDPNS
PLALALAARDRAMKEQQNHPQNQPQNPPQVPQAPKHEAQSLPVQPSHKPDLNQPLFIDTK
RQMTEQKYETDGAREERQHRALEERKSAPADVTDASKPKSAGLLMVHTSTDPNKTSNQDA
EGQDSNRPAELKDPNQPDPLKASMLAANPLPPSARRRSIPLGDSMDEPVKLPFRIPPPPL
ASVDIDEEFEFSEPLPPPLEFANSIDIPDDQASAIAEMLKQQRRNGGPALPPYHPHAPPP
VADHHKRVPNSKPPAYAPPPDHESAVGDSGIEEVDSRSSGDPQHMETTSTVSSISTLSSE
GGFCDSTLESLYTSADGHAFLVERPPVPPKPKGKSIINRTSLYHDALIEEAPESYGTPPQ
APPPPPSSSEPPRTPTQRSSKLWGRGSDGVMAEACLEDRSAEALRGGGGVRLRRTPPAVL
SLTPLPRRRSDGCRSSRPPLRNQHSPIRNRARPPAVSGSELSVCSVLTSDLRPPPGRVAQ
FEGPGATWGLPERPLRLDRMSPEQICRLRWGRGEEGHRSLLRSSSSSFLFSSRSRKLVAF
MPVKAAFGSGDTCWPRPTDDSGTRSNATTAAALSSTPPGSLPSQTHPCSPPDSASSLTPC
SSLPPSVSPTLTDVFGLATPPMGSGGGYSLSSSCGGSGSSRSPSPLTLMQAASASGKAFA
SKPVELWSKHDVADWLESLNLAEHRDAFLDNEIEGAHLPSLQKEDLIDLGVTRVGHRMNI
ERALKLLQDR
Download sequence
Identical sequences H3CGM8
ENSTNIP00000007406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]