SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CGR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CGR4
Domain Number 1 Region: 7-96
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.44e-18
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CGR4
Sequence length 599
Comment (tr|H3CGR4|H3CGR4_TETNG) Ankyrin repeat domain 13B {ECO:0000313|Ensembl:ENSTNIP00000007442} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RSPEKSRYPVHHLVWHNQARQLEKELASKAQMDLESLDPRGRTPLHLAVTLGHLDCARLL
LQQGADVSKENHNGWTVLQEAVSTRDPEMVRLVLRYRDYQRTAKRLASIPVLLERLRQQA
QDFYVEMKWEFTSWVPLVSRICPSDTCRVWKSGQCLRVDTTLMGFEQMTWQRGNRSLIFR
GKDSTAEVMEVDHDRQLVFCEALSISSLTGLPHGCVNGDAGGLGLLAMVQPSEQQVAARL
AAPVVTTQLDTRNIAFERNKTGILGWRSEKTELVHGYEAKVYAASNVELITRTRISHLSD
QNKNKTRGGKTPLQNFFGIAEQHIGSSNGALMTEMSCPAVTNPATLTAEEYFSSGWSPTL
RDIGPPCQLTTKTQRFKAKLWLCESHPLSLAEQVAPIIDLMAISNTLFAKLRDFITLRLP
PGFPVKIEIPLYHILNARITFNNLNGCEDGELGLEEDEERDALGSSLPSPGSDASSVSSS
TRVIPSCVFEVPPGYAVLGSKQREPLREEEEDLLQFAIQQSLLEAGSEHDQVTIWEALTN
SKPGTHPFPCTPCHLERSEVTQHVKKTSTSITTTTQQGVFWFHLPPQGPGQAQPPQQPP
Download sequence
Identical sequences H3CGR4
99883.ENSTNIP00000007442 ENSTNIP00000007442 ENSTNIP00000007442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]