SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CGU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CGU0
Domain Number 1 Region: 3-338
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.4e-71
Family Ankyrin repeat 0.0000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CGU0
Sequence length 503
Comment (tr|H3CGU0|H3CGU0_TETNG) Ankyrin repeat and SOCS box containing 2a, tandem duplicate 1 {ECO:0000313|Ensembl:ENSTNIP00000007468} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
WLAIHQAAWYGQDKCLRVLLSAQPGMINKKTERGETALMLAVGQEQVRCLQVLLENGADP
DVSNRDKETPLYKACERNSAAMVAALLNHGAAVNTHCILGWTALQEAVSRNNVEICEMLL
KAGAKHNLTNVYGIAPLFSAAQSGQLATLRFLLKHGADINSQAADGATALYEAAKNEHQD
IVEFLISQKADANKPGKTGLLPLHVAAQTGNDTIVSMLIAVTSKARVRRTGISPLHVAAE
HNCDDVLELLIQAGFDVNAQLSEERSKLYEDRRSTPLYFSVINGNIDAVQMLLAAGANPN
LDMFRPLMVAARQCCIKTVTLLVKHGADINASIPTHPTTFPAVYMFSMKYLPMFKFLLDH
GGHALCCFDCVYGGGPHPPINTSRSDRSDSVPDRRQRTGVQFCEMISAPSICRWAGPIID
LLLDYVGHVTMCSRLMEHLNSYSDWSVIKDRAAPPRPLLHLCRLRIQQLVRREEHHQKTE
KLLKSKTEEKLTNQEQKEGKKKK
Download sequence
Identical sequences H3CGU0
99883.ENSTNIP00000007468 ENSTNIP00000007468 ENSTNIP00000007468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]