SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CHH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CHH2
Domain Number 1 Region: 77-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 511-557
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 3 Region: 25-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CHH2
Sequence length 558
Comment (tr|H3CHH2|H3CHH2_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000007700} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
GQGPAGPRYRRLTAVFVSGSCVQPVGCRWGPFADWSECDGCSKTEVRTRHVETFAQFGGD
PCSGEATQTQACVPTKSCPLEAGCGNRFRCTSGQCISPALVCNGDQDCEDGLDERGCSPD
GSRSSCDLDKTPPNSDLVGKGYDILTGDLRAGVINTVSFGGQCRKVFSGDHKILYRLPQN
ILRYNFEDQPSWSWRMKDIESVSVTVNDEESDESFESSWSYMQSIQSNALWGHDRRKFHK
TVTESRVRPGCPWRPSPVSLLNKVELAQFQNTAPEYLTLAEGFWRALSSLPTTYDYAAYR
QLFQTYGTHYFSEGSLGGEYQALLELTQHALATTSTTSREYERCWRKVKRRFLRKKPVTV
SRGRAGSDSLFTPWSPGTSMRNVPIKVDVVGGNPGLKRFLSILDLENPEENGRKYDDWAS
SVKDFPQIIEQKVRPLYELVKEVECAGLKKLHMKQALEEYLSAEHPCRCRPCHNNGRPLL
LGSQCVCVCRLGTSGAACQSGAAVGEQPGVIHGSWSCWSSWVSCAGGQRRRTRTCTHPAP
SKGGLHCVGPQEEQKQCE
Download sequence
Identical sequences H3CHH2
ENSTNIP00000007700 ENSTNIP00000007700 99883.ENSTNIP00000007700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]