SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CHM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CHM4
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-26
Family Third domain of FERM 0.0071
Further Details:      
 
Domain Number 2 Region: 84-181
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-22
Family Second domain of FERM 0.003
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.47e-20
Family First domain of FERM 0.0028
Further Details:      
 
Domain Number 4 Region: 380-429
Classification Level Classification E-value
Superfamily RING/U-box 0.0000045
Family RING finger domain, C3HC4 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CHM4
Sequence length 474
Comment (tr|H3CHM4|H3CHM4_TETNG) Myosin regulatory light chain interacting protein a {ECO:0000313|Ensembl:ENSTNIP00000007752} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MLCYVTRPDSVVMEVEVDAKANGEDCLNKVCRKLGIIEVDYFGLQFTGAKGENLWLNLRN
RICQQMDHVAPCRLRLRVKFFVEPHLILQEQTRHIFFTHVKEDLHHGHLRMCSDQAVELS
ALLAQAEFGDYNQNTARYWYSELCGEEPSVDAIDSIISRHQTLAGLSQASVEYQALQLVA
ALEHYGVEWHWARDASSQRLAIGVGPEGIAVCKEDFSLVNRVSYPVIQIATQSGKTVYLT
VTKETSDSVVLLFKLISNRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDFKGHLASLF
LNENINLGKKYVFDIRRTAKEVYDHARRALYNSGIVDLVSRGGGEGEGPSPPRSPCRDEG
PDCGGCQQSRALQERLRKLREALLCMLCCEEEMDAAFCPCGHMVCCQSCASQLQLCPVCR
SEVDHVQHVYLPTCTSLLNLTLTDNHQHRAAIPAAIHRDLASPLSEYEPKVYHT
Download sequence
Identical sequences H3CHM4
ENSTNIP00000007752 99883.ENSTNIP00000007752 ENSTNIP00000007752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]