SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CJ46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CJ46
Domain Number 1 Region: 24-60
Classification Level Classification E-value
Superfamily PX domain 0.00000576
Family PX domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CJ46
Sequence length 137
Comment (tr|H3CJ46|H3CJ46_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000008275} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAVTEAGCDLTYCRMRGIVAVLTAFIKERKMGLNDFIQKLVSTPHICQHVEVNNFLKIDK
NQDEDSETGPLESQVGRHSEVICTLIPAVPWLRTLRSNRQLRKGSSGSAQGNHQILRCQS
AAEENHHQKEGAKAHHG
Download sequence
Identical sequences H3CJ46
ENSTNIP00000008275 ENSTNIP00000008275 99883.ENSTNIP00000008275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]