SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CJ51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CJ51
Domain Number 1 Region: 118-234
Classification Level Classification E-value
Superfamily EF-hand 1.14e-35
Family Osteonectin 0.017
Further Details:      
 
Domain Number 2 Region: 206-300
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.28e-27
Family Thyroglobulin type-1 domain 0.0008
Further Details:      
 
Domain Number 3 Region: 52-97
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000011
Family Ovomucoid domain III-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CJ51
Sequence length 310
Comment (tr|H3CJ51|H3CJ51_TETNG) SPARC/osteonectin, cwcv and kazal like domains proteoglycan 2 {ECO:0000313|Ensembl:ENSTNIP00000008280} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=SPOCK2 OC=Tetraodon.
Sequence
AVDTTKDPCQNVKCSRHKVCVAQGYQRAMCVNRRKLEQKVQQPGQPEGHERSCKSCPVTV
PSPVCGSDGHNYASECKLEQQACLTGKDLSVMCTGFCPCAASTITESKRGGQSIKRNSCT
GQDLADLGDRLKDWFQLLHGNAKQNNSGRPGSGTSSALDRSLGASCKDSIGWMFSKLDTD
SDLYLGQAELTAINLDKYEICIRPFFNSCDTYKDGKISMAEWCLCFWRETEPPCLAELEK
IQVQGAAKMNPGMYIPSCDEDGYYRKVQCHQSRGECWCVDQHGGELMGSRIHGNPECDEV
AGYSGDFGSG
Download sequence
Identical sequences H3CJ51
ENSTNIP00000008280 ENSTNIP00000008280 99883.ENSTNIP00000008280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]