SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CJF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CJF5
Domain Number 1 Region: 965-1259
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.09e-90
Family Complement components 0.0000294
Further Details:      
 
Domain Number 2 Region: 793-914
Classification Level Classification E-value
Superfamily E set domains 8.82e-34
Family SVA-like 0.0093
Further Details:      
 
Domain Number 3 Region: 1337-1459
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.09e-32
Family Alpha-macroglobulin receptor domain 0.0001
Further Details:      
 
Weak hits

Sequence:  H3CJF5
Domain Number - Region: 367-417
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0534
Family Invasin/intimin cell-adhesion fragments 0.0065
Further Details:      
 
Domain Number - Region: 133-191
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.068
Family Ferredoxin reductase FAD-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CJF5
Sequence length 1465
Comment (tr|H3CJF5|H3CJF5_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000008384} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MSSPVLATLALALAVAVVRSLSAPLNDTKFAVAVSSRLKGGEQETLCAHIQNAAQPVSLS
VSLETDSSSALVLMEDVQQDFYRCMNFQVPLTPSRTVASVNVTVSRGGQTLTKSSKVLIE
PPAFIHLIQTDKPIYKPGQTVQFRIVSTDIDFIPVKRVYTLVELLDPSGNRIAQWLDQVV
VGGILDLKHPMIPEAEQGRYTIGARTDKEEKIQHSFELKEYVLPKYEVKVLLPPVISILD
REATFSVCGKYTYGKPVLGSAKAVVCRKAFSFYWISSEKQPDLCQTFQLTTDKSGCASQT
INVGGFAPNKHTYVDRFEVSAELEESGTGVVLTGAGQTSFSSQVRAVTFKDTPESYRPGL
PFQGKVRMVGPDGKPVAGEPVYVSAGDSQSQTLTTDAKGTATFSFDTALWTGTLTLQPDL
RQPEYRSTTLRVAAFYSKSRSFLKLLQANGRLPCNKEAAVKVQYLLQGEELKGQEQLDCF
YLVTSKGRIVQHGRVLVAVKAGIVNTGEISVPLRQVGSLAPVAQVVVYAEMPGGEVVADS
QDYPVQLCLNNKVSLKFSSPQELPAEKTTLSLKAHPGSVCSVRAVDQSVLLLQAEEELSV
ASVFQQLPYQKLSGYAYEVEDSEPYPCLPRPMRGPVEGLLVEEGDGLPRSKRSFFYPQPD
QKNDVYSIFKEIGMKFVTNGDVKKPYDCLERFPIYAFYDGRSRTCTGPDMVDAPVPLAFN
TMVERGEVLRKDEQKKETLRTFFPETWIWDLVSVGDAGSVDLDKTVPDTITKWAAGAFCV
SSAGLGVAPGAALTAFQPFFVSLTLPYSVVRGEVFPLRATVFNYLSDCIMVQLTLAESDQ
YAFRSCDGCRYTACLCGEESATFTWIVTPAALGIPVKLKVSAEALKTDVLCGNEVATVPK
TGQIDTVVRTLLVEAEGTPEMVSHNALLCPAEGPKEKKVSLLLPEFFVAGSARASVSVLG
DLMGRAMKNLDQLLAMPYGCGEQNMVLFAPNIFILNYLQSTGQLTPDIREKATRFLESGY
QRELTYKHDDGSYSAFGKSDPSGNTWLTAFVMKSFGGARPFIFVDPKHIKDARRWLAEHQ
RPDGCIRSVGKLFHNGMKGGVSDDVSLTAYVAAAMLELEADLEEPVVQKCLECLRAAVSG
QLDNLYTSALLSYTFTLAKDEETRSKLLADLHQKSSDNGGTRHWDRAGASGRGLDSLEVE
MTSYVLLALLSGPALPGFGLDYASGIVRWLARQQNPYGGFSSTQDTVVALQALAKYGAAT
YSPEGSTTVTVTSLGGLRKEFTVDQSNRLLYQEEKLSEVPGEYAIRAEGRSCVLAQISAH
YNVPPPPGFSAFNVTASTTAKCGARRPQLLLVLDVGYRGRREETNMVIVNVKLLSGYVLE
PSSLDLLKRDTSVKRVDLEDGYVNVYLDGLKKAETKTYSLTLEEELPVRNLKPAVVKVYD
YYQTGDVAATEYSSPCSEGESRGPS
Download sequence
Identical sequences H3CJF5
ENSTNIP00000008384 99883.ENSTNIP00000008384 ENSTNIP00000008384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]