SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CJN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H3CJN7
Domain Number - Region: 400-454,572-602,662-686
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0547
Family Ankyrin repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CJN7
Sequence length 1247
Comment (tr|H3CJN7|H3CJN7_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000008466} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
QRVWIEKTFQKRECIQVLSSKDSSRCGCGQLIVQHHPLQTGNKDEESPLVDVTVPTTERW
SVLKHTQASPTDAYGLIEFQGGGQVNKATYIRVSYDSKPDSLLHLMVKEWQLELPTLLIS
VHGGLQNFELPPKLKQVFGKGLIKAALTTGAWIFTGGVDTGVIRHVGDALKDHSSKSRGK
VCAIGMAPWGIVENKEDLVGRDVTRPYQMMSNPFSKLSALNSSHSHFILADNGTTGKYGA
EVRLRRQLEKHIALQKINTQSRLGQGVPVVCLILEGGPNVISIMLESLREEPPVPVVICD
GSGRAADIISFAHKYCEEDGMLSDNIKDQLLVTIQKTFNYSRSQAQHILLMVTECMKKKP
LITVFRMGLEGQQDIEMSILTALLKGTGTNASASDQLSLALAWNRVDIARSQIFVFGLHA
PVNSLEQAMMDALVLDRVDFVKLLIENGVNMNHFLTIPRLEELYNTKLGPVNTLHFVVRD
VKKGNLPPDYQITLIDIGLVLEVLMGGAYRCKYTRKSFRTLYNNLYGLKRPKALKLLGME
DDEPRSKGKGKKNKKKEEEVDIDVDDPEVSRFQYPFHELMVWAVLTKRQKMALFLWQHGE
EAMAKALVACKLYKAMAHESSQSELVDDIFQDLESNSREFGQLAYELLDQSYKRDEQVAM
KLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGCLRMGKSNSLKVILGII
FPPAILLLDFRLGEEASNPSENQESGTKDEDNKSSKVRALGAAPPFCPLRPVDVASNVDV
TSKKGDEEEEQKKSKRRTPVVKKIFEFYNAPFTKFWFNTISYLVYLMLYNYIILVKMERW
PSLQEWTVIAYIITLGLEKVRQILMSEPGKLKQKINVWLEDYWNITDLVAISVFLLGLLL
RLQNEPSMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLVV
LMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDPPCGDNMYDEDGKKLP
PCIPGAWLTPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHD
RPILPPPLIIFSHIFILLRRLLCPCRHRPDGERDHRERGLQLVLNPEELKSLHEFEEQCV
EEYFREKDDEKQSSNNERIRVTSERFRVENMFMRLEEVNEREHSMKASLQTVDLRLAQLE
EFSGRMMHALEKLAGVERDELLGRRSRGSSVCEAALLRHGSINSGDG
Download sequence
Identical sequences H3CJN7
ENSTNIP00000008466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]