SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3CJR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CJR3
Domain Number 1 Region: 94-168
Classification Level Classification E-value
Superfamily E set domains 0.0000147
Family Filamin repeat (rod domain) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CJR3
Sequence length 430
Comment (tr|H3CJR3|H3CJR3_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000008492} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MNGLKLLDSLFSSASASTSQLRPTDAVANITLEFHEDHQNFCTFRPLSPEEALEEKLLLA
SISWPATLVLPEPVSLDQTSDPAHSAFTLLPRDGGGQWRVGDRLEVLIEMRDFRGIPKTS
GGDVLLARLHDSVLGAGVAGRVVDHLNGSYSALFSLPWEGSAQVEVTLVHPSEGVTVLRR
LTSEEPDRITFRSLFHSGRRSETTACNLCLRPSRQPLCNYTDPRTGEPWFCVKPRTLECR
ARISHAKGAFHQKLRAKEEKLFQSGVNMKVSIPAFGPDKLTILPNEKGIDMLSLNHLLEK
MWQXGGTAVHQFNTPPAVSQCLKGKAMHFYGDSTVRQWYEHLVTTVPELKEFNIGSDKQV
GPFMALDYANHIMGLTYRCHGPPIRFAIPSSADIANELDGLIGGANTVVVIGIWSHFSTF
PIQVYIRRLL
Download sequence
Identical sequences H3CJR3
ENSTNIP00000008492 99883.ENSTNIP00000008492 ENSTNIP00000008492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]