SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CJT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CJT4
Domain Number 1 Region: 1-20,51-67
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000288
Family Thyroglobulin type-1 domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CJT4
Sequence length 132
Comment (tr|H3CJT4|H3CJT4_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000008513} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
CDESGTFLPVQCVFINTTTGTHLDLMSIFSSFPEAFETFAGFRKLFPTVSSYCFCSDSRG
REMHNTGVELLLSDVYDSAFVAHPPIHTFAQSNIYQVLQRRMLAVRLAVTGHFRCPSSCE
EEQRSAKEALNV
Download sequence
Identical sequences H3CJT4
99883.ENSTNIP00000003716 99883.ENSTNIP00000008513 ENSTNIP00000003716 ENSTNIP00000008513 ENSTNIP00000003716 ENSTNIP00000008513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]