SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CJW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CJW7
Domain Number 1 Region: 4-112,200-308
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000000102
Family LacY-like proton/sugar symporter 0.081
Further Details:      
 
Domain Number 2 Region: 132-167
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000665
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CJW7
Sequence length 341
Comment (tr|H3CJW7|H3CJW7_TETNG) Solute carrier organic anion transporter family member 3A1 {ECO:0000313|Ensembl:ENSTNIP00000008546} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=SLCO3A1 OC=Tetraodon.
Sequence
VIPRVTRHLLSNPVFSCITLAACMEIAVVAGFAAFLGKYLEQQFHLTTSSANQLLGMTAI
PCACLGIFLGGLLVKKLSLSALGAVRMAMLVNLVSTACYVSFLFLGCDTGPVAGVTVNYS
NETSPSRSPPAPSCISNCNCRTASASPVCGSNAVTYLSACFAGCTRANLSGCWCVSGSSA
QAVASPGRCPRPGCQEAFLTFLCVVCVCSMIGAMAQTPSVIILIRTVSPERKSYALGVLF
LLLRLIGFIPPPLIFGMGIDSTCLFWSTVCGERGACLLYDNLAYRHLYVSIAIVLKSSAF
LLYATTWRCLRKNYRQYIRNGEGALTPSQLFASSLTLDHLG
Download sequence
Identical sequences H3CJW7
ENSTNIP00000008546 ENSTNIP00000008546 99883.ENSTNIP00000008546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]