SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CJZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CJZ0
Domain Number 1 Region: 266-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-42
Family MAM domain 0.0015
Further Details:      
 
Domain Number 2 Region: 587-746
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.86e-39
Family MAM domain 0.00081
Further Details:      
 
Domain Number 3 Region: 752-907
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-33
Family MAM domain 0.00054
Further Details:      
 
Domain Number 4 Region: 57-218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-28
Family MAM domain 0.0024
Further Details:      
 
Domain Number 5 Region: 916-1078
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.93e-28
Family MAM domain 0.0024
Further Details:      
 
Domain Number 6 Region: 460-500
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 500-585
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000222
Family MAM domain 0.017
Further Details:      
 
Domain Number 8 Region: 13-43
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 9 Region: 226-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000864
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CJZ0
Sequence length 1078
Comment (tr|H3CJZ0|H3CJZ0_TETNG) MAM and LDL receptor class A domain containing 1 {ECO:0000313|Ensembl:ENSTNIP00000008569} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LPVSAELLPARLEFTCSQGWCVPPDHVCDFRNDCEDGHDEEYCDILCDEDSIGVATVCDF
DDGSCGWFELTPGDGFDWVRGTSAEVPPHFYGYPPPLDHTTSSTEGHFMFILKNSSSLYP
QAVLQGPWFRQSASGCTMTFWHYNSGISVGAANMNLRIKGDPNNTVIWRTLYDQGPQWKQ
TTVQLGRLTQPFQISLSKISLGVFDGVSALDDVTFSNCSMPPAVAHCPKQTHFHCTHSKA
CVESLRLCDLLDDCGDGSDEDGCSPELQCNFEEGLCSWTQEQSGGDVFDWTRIQGPTPTF
NTGPWKDHTLGTISGHYLYIESSEPQQFKDTAVLLSRLFQPTVQRSKDPSSAHCVFRFHY
HMFGSHVFCLAVYMRTTATGRGSVLWVQYGNQGNMWHRKTLYLSSSKPFQILIEGTVGDD
FKGDIAIDDLSFLDCEPYEGNLPTVNHTIPTVTPPAPTIQPHSCPEGQFVCRTHGECVSY
TKVCDFRPDCSDASDEFACVREQCTFEGGETCGWKTVDSSVVDAHAFRWSPNQGESTQGT
PEGWYLCADSSNGGYGHITDLQTPVIASTGAQCILVFWYYMCQTEGFSGRCNFEFDMCSW
RQGQHDDFDWLIKAGSTPTVGTGPSGDHTLRNSSGHYIYLESSFPQAVGDIAYISGPLLS
RRSSQCKMRFYFHMSGDGIGTLSVFRRSQGHHHLLLKLSGDQGNYWQMGEVPLSDIWDFQ
VIFEGKVGRIPKGDICLDDITFSPGCLLASAPRDCSFEKGYCGWKSSQADNYDWKLGVGS
VKSTQPPYDHTLMDGAGHFVSLEATPVGLKGDKAHMRSSVWKESSAICKLSFWYYISHKA
SGKIRVLIKMENDMWEAWSKSGNQGSRWNQAVVPLRNLRNFELIFEGIRSWDLSGGASLD
DLEYLDCAPNHIFALPGACDFNMEDDQWEAACQLSQDSTDDFDWRIEHRSETGPQNDHSP
VWCVQGGKGKFLYAHSAVQREGDIAKVTTRRLFPASIGRCHLRFWFYMHGSDRMGTLKVY
TVGTSGSSLLMWAATGNHGRKWTYADVILSNTTPFRVTFQAEVGGDVWTDIALDDVSY
Download sequence
Identical sequences H3CJZ0
99883.ENSTNIP00000008569 ENSTNIP00000008569 ENSTNIP00000008569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]