SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CK39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CK39
Domain Number 1 Region: 477-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000024
Family Laminin-type module 0.0093
Further Details:      
 
Domain Number 2 Region: 314-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 3 Region: 248-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000753
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 4 Region: 428-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000165
Family Laminin-type module 0.0083
Further Details:      
 
Domain Number 5 Region: 393-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000268
Family Laminin-type module 0.031
Further Details:      
 
Weak hits

Sequence:  H3CK39
Domain Number - Region: 827-1056
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000128
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.018
Further Details:      
 
Domain Number - Region: 525-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000137
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 85-146
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000181
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.055
Further Details:      
 
Domain Number - Region: 643-764
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.0327
Family Chemotaxis phosphatase CheZ 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CK39
Sequence length 1063
Comment (tr|H3CK39|H3CK39_TETNG) Laminin subunit beta 3 {ECO:0000313|Ensembl:ENSTNIP00000008618} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=LAMB3 OC=Tetraodon.
Sequence
VTPFLPAVVVATARGSNDCSRGACYPPSGDLLLGRAQQLRASSTCGLTGSEVYCTPYQQR
RMKCCPCDSRNPNGQLAHTVQEVLATSGPDRWWQSKKDVNPVTLQVDLNNLFQLHNLALN
FKGPRPSNFVIERSLDNGSTWKPALYLATDCQKAFPGVQTTEPLRLDEPHCFTLPPTGSD
PYKDQMVQFNPLRQYTYVSAPNSEKVEKLSGLTGLRVRMTGLGGVPRLPGRSLSQFFAIK
EMRMMGSCMCHGHANRCLPDSTAQEGMQSVLQVNPRCDCQHNTAGMNCERCDDLFNDLPW
RPAEEGNTHTCQRCECNGHARRCHFDLATYEASGRRSGGVCEDCMHHTTGPKCDRCAPGY
QPNPRSQMDRPDACIRCPCSTEGTVENGQCDTASSCQCKVNVEGPRCDRCKRGYFGLSTV
NPLGCSKCSCSSEGSVSDACDPVTGQCLCRPNFHGPNCDVCSNGYWKPFLSDRCEPCKCD
PTGSYSNTCDQVTGQCHCRPHFGGRTCTECPDNMFGDPPSRCQPCQCDLEGTLAEGCNKQ
TGACLCRPGVTGSRCTSCSRGHCDSFPLCESCPSCFFTLDSQRQNLSLILKSITTRFPTT
PDSSNVNFGLRILALENRLKLLRESISFPPSIARQVDDALTQLDKLRNQLKKINDGLSPL
IQTPGLDSELDKLQVLLERLEGVYKAKSSSVENTLGPNDCQSGAFSAIRQAHKKSSEAAG
KVNASEQTLIESADVRENALDLLQQVQPANTRALNKLNQVMSSQPDLTPVAKQVCGSVRS
EPCTPLLCEGNDLCPPEGAPLCKTAEKCVGAGPLSKRTDADVKNVKSKLDRLAKKITDAA
EKLLETQETTNQVRQSAAKLSKKMRQTRDRVENDLEETRGIVKDLKDFLSDPSSNLTHIQ
VVSEWILATNLSLSPATLKKKLEELNNLTANLPDSLSVLNDAAPQLDAAKKLLEDAQKTR
DRALDIEDNVDTRVSGLDLLDKSLSDIEDKVQNSTGLTDGLKTLLLQIKDQLSPAERNLD
DATTLMKPMTVQLGQLKDLLENVRQKAQGARDSSEAAEREAVA
Download sequence
Identical sequences H3CK39
99883.ENSTNIP00000008618 ENSTNIP00000008618 ENSTNIP00000008618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]