SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CK96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CK96
Domain Number 1 Region: 5-68,109-164
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 9.81e-16
Family NAD kinase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CK96
Sequence length 283
Comment (tr|H3CK96|H3CK96_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000008675} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
AVLAVSSSTSRDKPVVGVNTDPERSQGHLCLPVRYTRAFPEALEKLARGEFRWLWRQRIR
LHLEGTGINPTPVDLHEQQLSLEQHSRAHRITTLQHRRRGPAEKSSEPRLLPVRGLNEIF
IGESLSSRASYYEISVDGGPWEKQKSSGLSICTGTGSKAWSYNINKLGEQAVEEILTTGR
SQAGTQLPLDRSFIQAVTERYNASLVFPPADGRLLFSVREPIVNRVFFSSRQRGFASRLC
VRSRCWDACMVVDGGTSFEFNDGAIATISTSEEDRLRTVVLDG
Download sequence
Identical sequences H3CK96
ENSTNIP00000008675 99883.ENSTNIP00000008675 ENSTNIP00000008675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]