SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CKD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CKD5
Domain Number 1 Region: 496-656
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-42
Family MAM domain 0.00061
Further Details:      
 
Domain Number 2 Region: 330-489
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-27
Family MAM domain 0.0024
Further Details:      
 
Domain Number 3 Region: 159-319
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-25
Family MAM domain 0.0017
Further Details:      
 
Domain Number 4 Region: 23-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.75e-18
Family MAM domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CKD5
Sequence length 678
Comment (tr|H3CKD5|H3CKD5_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000008714} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
HLLLTPLNDVRTATLTSASKVLAGSCSFERDTCGYSPAPELGGWSRNHKGRSILVDSASL
RGQEQAVLVSPVLERPGWSCVRLVYQISGRGSLQLHLRPQGDNFDYRLWWTREASDSWLI
ASVDLPNGTAPFQLLLEGGPGPGSSSRVEVFEILVVPGYCLECDFEEEHRCGYSNSWNPN
VNWYVGGSAAAGNQTDGQQRATLSPAPGQYMFVDSEHVRHFQEVAQLSSPMTTAPMAGCL
SFYYRDQQRGNVFSLFTRDQLGHYEEIWRPQVDATPGWTLVGVDIRAPHPLEVVFEVAFN
RAKGGYVAVDDISFSPEFCHSDTEPTVDPSVADCDFDTGLCLYHQERAESKGWSRVTVSP
NAYRMGDHTTGTGWFLQANVRSASTPGYVGRLHGPLLPGNQRYCVRFYYLLQASRKVDNA
LILYVYDEHDVAVEKVWSLSGSSGAVWTRVEVTFLKPMLTKLVFASICRNFWECGLVAID
DITVRLGDCRIAAGSLPGQCDFDDGLCGYRQDTVEDKGDWLPARGHTPTSYTGPRGDHTT
GVGSFLYIEASKMRPGHKARLLTSDLRGSSSPQCLVFHFHMYGSGSGILSVLLRQGGGQP
DSLLWRRRGEQGIGWMRATVDYRCGVRHQIVFEAIRGPSLRSDIAIDDVAFQPGPCEGEI
RSQSQSSSFSQDLLNQNS
Download sequence
Identical sequences H3CKD5
ENSTNIP00000008714 99883.ENSTNIP00000008714 ENSTNIP00000022040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]