SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CKK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CKK5
Domain Number 1 Region: 375-483
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 8.37e-26
Family FAD-dependent thiol oxidase 0.0044
Further Details:      
 
Domain Number 2 Region: 8-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.88e-17
Family PDI-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CKK5
Sequence length 614
Comment (tr|H3CKK5|H3CKK5_TETNG) Sulfhydryl oxidase {ECO:0000256|RuleBase:RU371123} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
AASLYTDEDPLVILSSGSLRSSVTNSSSAWLLQFFSSWCGHCIQYSSTWKVLAEDVKDWQ
AVIAVSVLDCAQEENHEICREFGIQLFPTIKFFHAHSPETDRGTPFRGANRQVQTVRQVM
VDILQNHTKLDWPDRCPRLEPYSSEDLLPRLGQRSEDYTAIVVEEPDSYVGREVILDLLM
FSGVQVKRALSSERPLVEALGVTSFPSLYLLHPNSTHTEPRVEKKQRFFFSSFLKTLPGV
QRKAGGRSSAAGLQEAAPGRGASESWRRFDSAKVYTADLESGLHYLLRVELASHDYLEGE
ELSIFKDFVTLVAKLYPGGGSVVRLMEALSDWLLSLQGRRLVYQNVLDLVDNKMRVRQCV
PGGGVRWVGCQGSRAGLRGYPCSLWTLFHILTVQHAAKPTALENTGGSREAAPVLQVMRR
YIRTFFGCQECGRHFEQAAAAGLDQVQNPDQQILWLWEQHNRVNSRLSGTLSDDPLFPKA
PWPGPALCATCHEEKNGARWNRDNVLVFLRRHYGASNLSHRHAISPPGPAQLRPAGQEQN
QEQQPDSGPGPQSGQQEAAGPGGGLWVLGLGFSATDMSLCVLLYVCSCLVLMLLFFFFKV
KSKRWRRRKSPLQV
Download sequence
Identical sequences H3CKK5
99883.ENSTNIP00000008784 ENSTNIP00000008784 ENSTNIP00000008784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]