SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CKS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CKS6
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.24e-41
Family Ankyrin repeat 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CKS6
Sequence length 135
Comment (tr|H3CKS6|H3CKS6_TETNG) Ankyrin repeat domain 1a (cardiac muscle) {ECO:0000313|Ensembl:ENSTNIP00000008855} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
QFQRTALHKASFKGHVDIMKRLLEAGASMDKKDKLEATAVHWACRGGSLPALQLLLNQGA
KLTYRDKLHSTPLHVAVRTGHCKCAEHLIHCGADVNAKDRDGDTPMHDAVRINRFKMIKL
LMMYGANLSTKNTVG
Download sequence
Identical sequences H3CKS6
99883.ENSTNIP00000008855 ENSTNIP00000008855 ENSTNIP00000008855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]