SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CKZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CKZ6
Domain Number 1 Region: 64-502
Classification Level Classification E-value
Superfamily Sema domain 1.27e-95
Family Sema domain 0.0000043
Further Details:      
 
Domain Number 2 Region: 499-528
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000379
Family Plexin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CKZ6
Sequence length 529
Comment (tr|H3CKZ6|H3CKZ6_TETNG) Si:ch211-113g11.6 {ECO:0000313|Ensembl:ENSTNIP00000008925} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RPHPHPHSLEPPASEVEPDAPTSPTECRRRRRAASGPGPAAESGTHHLREGPSTAVRKSE
LKSSRFHFHKPENYISMYHQEGSDTMYVGGRAVIYVLTFTSRGVHDLQTAINTCKAKGAP
LEQLECDNFITVIQKVNDTMIVCGTNAGNPRCWMLVNDSVLTDVQGGQIASASDISPAYP
SQRSISFPADGSLYSAMSSTAGHSGSIRRTFGSQKLLKTENVWLLNPQFAGAAIIPSSHK
VKEEMYFFFSEFNKTARVDEEPYRARIGRICTVDEGGIKTLLADSWTTFMKARVMCGAGN
TQQQYNNLKQAVVLTAQDRRAGVLYGLFSNAWGRKVICAYSIEDIDQAFSTSKLRGYSSP
FIGIRPGVCVRKNSSPVSQNDIKNLGVIRYHPEIEDVIRPVGVAPLDLPADDQITHMVAD
IVLAVNDEHYSVLYLGTKSGMTHLLSWPRPQRSRASFTISQYSLFHNEGPVLNMAIDSQK
GHLYVGTAMEVQPLPLADCGRYGDTCRECILSRDPYCGWDRARRRCIAI
Download sequence
Identical sequences H3CKZ6
99883.ENSTNIP00000008925 ENSTNIP00000008925 ENSTNIP00000008925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]