SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3CLD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CLD7
Domain Number 1 Region: 955-1248
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.7e-75
Family Complement components 0.00000221
Further Details:      
 
Domain Number 2 Region: 1475-1628
Classification Level Classification E-value
Superfamily TIMP-like 7.32e-34
Family Netrin-like domain (NTR/C345C module) 0.00087
Further Details:      
 
Domain Number 3 Region: 1322-1476
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.24e-33
Family Alpha-macroglobulin receptor domain 0.00085
Further Details:      
 
Domain Number 4 Region: 636-702
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 1.83e-16
Family Anaphylotoxins (complement system) 0.0027
Further Details:      
 
Weak hits

Sequence:  H3CLD7
Domain Number - Region: 787-834
Classification Level Classification E-value
Superfamily E set domains 0.000136
Family SVA-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CLD7
Sequence length 1630
Comment (tr|H3CLD7|H3CLD7_TETNG) Complement component c3b, tandem duplicate 2 {ECO:0000313|Ensembl:ENSTNIP00000009066} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
FTLLAPDLLRTDSQENIYLQAETVTTPVTVSISIQDFGKTTMLLRDSVILNQENGFHALK
SIQLSSVSLRREEKKNKFVYLKVVFEGFHTEERVLMVSFQSGYIFIQTDKPIYNPGDTVR
YRAFVSSPSFKAFDSSITVDIQNPSGVVVKQISRTRAVSGIYADTFPLSEMVNEGTWTVV
AKFDHWKQNTFTAPFEVKKYVLPAFNVTLTPRKSYFSLHDNKLEVEVSARYLFGEPVQGT
AYVVFGIKINQEMIRLPSVKKVTDLDGGIVRLHVGDIKKLYPDMRLLVGNSIYVKASVVT
TSGSDLVDAEKTGIKIVQSPYVVSFKDTIKYFKPDLPFDFTIQVSNQDGSPAHNVPVKVN
LMDSPLMVSDGVVRATVNMPKTQQPQAETVQADLTPEQQAKQQITVQPFFPFSRQQQNYL
YVSSGTNKVSVGDNLVLKLSISTSDPTVRENIKHITYVVLSKGRIIVAERVSVAGQLLTS
IRLLITPEMMPSFRFVAYYSIPWTGGEEVVPDSIWVDVEDSCAGGLEVGPVDGILRDYTP
GKSFHFQVRGDPGSKVGLVAVDNAVFLLNKNRLTQGKIWDVVEGGDMGCTRGGGRDARMV
FSDAGLLYASSARFYTQTRQDLQCRVSSKRKRSAELLQRKTQLENYYKEKLQHRCCQDGL
RDIPMPYSCTRRSLYITEGWDCIRAFRHCCASYRGFRSVFTRNHSLGSAISAFLCICYDE
NDIYLRSKFFESWLWRTVDLPAQADRDGMATKNLDSALPDSITEWGVLAISASPDTGFCV
AQPYNVRAWKRFFVDLRLPYSVARNEQVEIKAVIHNYGDEDMHVRVVLMKTEHMCSIAFK
DRHTQELKVAAGSSVAVPYTIVPLAVGKLPVEVMVVGRGLTGEDRIQKLLRVVMDGVQKT
EVWSAVLNPTAEGGKQLVRVDKVRLESVVPNSQPETFINVRGNVLADSIDNSITEDSLAS
LIRMPGGCVEQNLASITLPLIATLYLERTEGWESVGVQRKAEALRYIRRGYENQLVYKLS
DGSYPPYRRQGASTWITAYVVKVLSMAHSIIGVNEQQVCDPLLYLVKNKLQPNGVYIEHN
PVYSTTMTGGLRGEDPQITLTAFVLIALAEAKQAGFSCSDPNVNLESAMSKTAEYLKRVI
VLSARRPYTVAIVSYALVLAQKNPQYSPLSYLMRAAAPGRDHWPNDQNALFTLEATGYAL
LALVKLGRMEEAELAFRFLNSRRGRGGGFGSTQSTMVVLHALSEYLIQKPPPEDLSLDVD
VRIRGRREIRYHFDPSTAYAARSSRLPADLDLEVEARGNGQGILEVVTFYNQLHEVEEKK
PCKHFELDVTIKESSAEKPPADVEKSYQLTVKVRTLGPRDVRMVVLDISLPTGFTPENSD
LEMLSNSVDHYISNFKVVDNLSDRGSLIIHLFKVSHKEQEILVFRLQQSFRVGLLQPSPV
TVYEYYSPDHRCTRTYSPSGRTEELTKICRDNVCRCTQGDCCISKGETENFPNKERETFA
CSSLHHVFKVKVANVSQSYYDSYEMEILQVIKLGVEPGVQPGHRRFFMAHGGCRDGLELK
LGSQYLIMGPKEDRWSIDSSTNQFLYMLGKDTWVERWPTPAECSSTGSLPVKCKSLAEAA
NELTINGCRL
Download sequence
Identical sequences H3CLD7
ENSTNIP00000009066 ENSTNIP00000009066 99883.ENSTNIP00000009066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]