SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CM12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CM12
Domain Number 1 Region: 65-131
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 6.24e-16
Family Ovomucoid domain III-like 0.005
Further Details:      
 
Domain Number 2 Region: 163-224
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000277
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Domain Number 3 Region: 256-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000558
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CM12
Sequence length 363
Comment (tr|H3CM12|H3CM12_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000009292} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VDVTSSNMVPEPRFSCSWWVLLVLLLHAVRGSFPRSGGAGGPACGPGRSGDCPDLSEKKS
DLRVCDAGTCRYGGTCLENGGDIKCACLFQCSKKYVPVCGSNGDTYQNECFLNRAACKKQ
RAITVLSDGACYHDGGSGSADGDDDGSGHSRIKLSKMWHLQVCERECDEDSEDVLCMCNI
VCNGHNDNPVCGSDSVTYDTPCHVREASCLKQQKIDIRHVGRCQDKTRKDGGPKPKPDIN
AVFTPGDGEAFGDGLGPCPQNYEHFCEHGECEMRQNLPTCSRCESSYGGPQCDQLLDFNV
LYVVPSGQKLHYVLIAAIIGAVQIAIIVAVVMCFTRRCNRTKRGRRQKQHLGHFSSGTSS
RMM
Download sequence
Identical sequences H3CM12
ENSTNIP00000009292 99883.ENSTNIP00000009292 ENSTNIP00000009292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]