SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CM49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CM49
Domain Number 1 Region: 291-466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-51
Family SPRY domain 0.0000319
Further Details:      
 
Domain Number 2 Region: 83-146
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000168
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 12-82
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000201
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CM49
Sequence length 478
Comment (tr|H3CM49|H3CM49_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000009329} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
GLSSDLMATRLCEDDLLCPQCSDIYCLPVLLQCGHNVCKVCLHKFWELKGCRECPVCRVV
SVPERPPINLALKIAAETYQVQRTSRDQDVCLFHNEKLKIFCQNDEEPICLVCQTSKRHK
VHECYPVVEASQLKKKEISAMLEPLKKQLRKLDKTREQWEETRTYIQTQAVENEKAIREE
FEKLHSFLVEEERNRLKVLRQEEEIKKQVMTEKLKTLTEKIESLSATISDVETTLKEKDL
PFLMEYKQTKKRARCSLHEPECIRDILINSAKHLGSLRFGVWNKMVASVKCAPFVLDPNT
AQSNLRFSEELTCVQYSSKQALPDNPERCTSRVCVLGATGFTSGKHSWTVDVGQGKDWYI
GAAAESIKRKTAVFLNPAEGFWVIGLCNGDTFWAQTAPRVKLALKQKPERITVKLDYDKG
KVVFINAEDSTTIHTFSDKFVERIFPYFSPGLYKDGKTSSPLTVCPQKITVNKYSTDV
Download sequence
Identical sequences H3CM49
ENSTNIP00000009329 99883.ENSTNIP00000009329 ENSTNIP00000009329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]